(data stored in ACNUC9435 zone)

EMBL: CP002400.PE198

CP002400.PE198       Location/Qualifiers
FT   CDS_pept        complement(212436..214499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0202"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   DEAD/DEAH box helicase domain protein; nucleic acid binding
FT                   OB-fold tRNA/helicase-type; helicase domain protein; KEGG:
FT                   aoe:Clos_1441 ATP-dependent DNA helicase RecG; SMART:
FT                   DEAD-like helicase ; helicase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25789"
FT                   /db_xref="GOA:E6U6Q6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6Q6"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ADU25789.1"
FT                   /translation="MEELARNVRTLRGVGPKRAALFAKLGVHTVRDLLYTFPRSYEDFT
FT                   RPVSISQAAPGEVCCIRAVVSAPIRVTRASGGMLLCKTRVADDSGILEVVFFNNKYAAE
FT                   LLKEGAAYFLYGRVSGTLFRKTMTAPECLPAGCNPGLRPVYATTAGLSSRAVGAAVQAA
FT                   LSLFATRTIPELLPDTLRAEYQLCRVGCALQNIHFPRDGQALAAARRRLVFDELLALLL
FT                   GMGLLRHRQADGHAPRCLPDFDFAPFFASLPYTPTGAQLRAVAEAAADMARAVPMNRLI
FT                   EGDVGSGKTTVAAALCVLAHAGGLQSALMAPTEILAAQHARNLERLLAPSGLRVGLLTG
FT                   GLPAAKKREVKAAIADGSVGLVVGTHALLQEDVAFHRLGLVITDEQHRFGVAQRAALAA
FT                   KGSTDAVDSSSPHMLIMSATPIPRTLSLMIYGDLDVSVLNELPAGRRPVRTYLVGSGLR
FT                   ARVHRFLRTQVEQGQQAYIVCPLVEADESELAAAVQLRDGLAETSLAGIPVGLLHGRMP
FT                   AREKEKVMQAFAAGDLKLLVSTTVIEVGVDVPAATVMVVENAERFGLSQLHQLRGRVGR
FT                   GAAQSHCILISDAEDAATRERLQTLCKTADGFAIAEQDLKLRGPGDFFGKRQHGLPALA
FT                   IADLMGDMDILQEARRAADTLLRQDPALSLKEHAGLRNAVDALFAGNGIVFN"
     atggaggaat tggcgcggaa tgtgcgcaca ctgcgcggtg tagggccgaa acgggccgcg        60
     ctgtttgcga agctgggcgt acacaccgtg cgggacctgc tgtatacgtt tccacgcagc       120
     tatgaagatt ttacacggcc ggtttcgatc tcgcaggcag cgccgggcga ggtgtgctgc       180
     atccgtgccg tggtgagcgc gcccatacgg gtgacgaggg cgagcggcgg catgctgctc       240
     tgcaagacgc gggtggcgga tgacagcggc atactggaag ttgtgttttt caacaacaaa       300
     tacgctgcgg agctgctcaa ggagggcgca gcatatttcc tgtacggccg ggtgagcggc       360
     acgctgttcc ggaaaacgat gaccgccccc gaatgtctgc ctgccggctg caaccccggc       420
     ctgcgcccgg tgtatgcgac cacggcgggg ctttcttcgc gtgcagtagg cgctgcagtg       480
     caggcggcgc ttagcctgtt tgcgacccgc accattcccg aactgctgcc cgacacactg       540
     cgggcggagt accagctctg ccgtgtgggc tgcgcgctgc aaaatatcca ttttccacgg       600
     gacgggcagg cgctggccgc cgcgcgccgg aggctggtgt tcgacgaatt gctggcactg       660
     ctgttgggca tgggactgct gcgtcaccgg caggcggacg ggcacgcgcc gcgctgtctg       720
     ccggattttg attttgcacc gttttttgca tcgctgccct acacgcccac cggcgcacag       780
     ctgcgcgccg tggcggaggc ggccgccgac atggcgcgcg ccgtgccgat gaaccgtctg       840
     atcgagggcg atgttggttc cggcaaaact acggtggcgg cggcgctctg cgtgctggcg       900
     catgccggcg ggctgcagtc ggcactcatg gcccccaccg agattctggc cgcgcagcat       960
     gcgcggaatc tcgaacggct gcttgctcca agcggcctgc gggtcggcct gctcacgggc      1020
     gggctacccg ctgcgaaaaa gcgcgaagtc aaggccgcga ttgcggacgg atcggtggga      1080
     ctggtggtgg gcacccacgc cctgctgcag gaggatgtgg cgtttcaccg cctggggcta      1140
     gtcatcaccg atgagcagca ccgtttcggc gtggcgcagc gggcggcgct tgcggcaaaa      1200
     ggcagcacgg atgcggtcga ttccagctcg ccgcacatgc tcatcatgtc ggccacaccc      1260
     atcccgcgca cactttccct gatgatatac ggcgacctgg acgtatcggt gctgaacgaa      1320
     ctgcccgccg gcaggcggcc ggtcagaacc tatctggtgg gtagcggctt gcgtgcgcgc      1380
     gtgcaccggt ttctgcgcac gcaggtggag caaggacagc aggcgtatat cgtctgcccg      1440
     ctggtggaag cagacgaaag cgagctggcc gctgccgtgc agttgcggga cgggctggcc      1500
     gaaacctctc ttgccggaat accggtagga ctgctgcacg ggcggatgcc cgcgcgggaa      1560
     aaagagaagg tcatgcaggc gtttgccgcc ggtgacctga agctgctggt gagcaccacc      1620
     gttatcgagg tgggagtgga cgtacccgct gccactgtga tggtggtgga aaatgccgaa      1680
     cgcttcggcc tttcacagct gcaccagttg cggggtcggg tggggcgcgg cgcggcgcag      1740
     tcgcactgca tcctcatctc cgatgcggaa gacgctgcaa ctcgtgagcg gctgcaaacc      1800
     ctgtgcaaaa cggccgatgg gtttgccatc gcagagcaag acctgaagct gcgcggcccc      1860
     ggcgattttt ttggcaaacg gcagcatggc ctgcccgcgc tggccatcgc cgacctcatg      1920
     ggggatatgg acatattgca ggaagcgcgc cgagccgccg atacattact gcgacaggat      1980
     cccgcgctgt ctctaaagga gcatgcgggc ctgcgcaatg cggtggacgc actgtttgcc      2040
     ggaaacggca tcgtattcaa ctga                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page