(data stored in ACNUC9435 zone)

EMBL: CP002400.PE213

CP002400.PE213       Location/Qualifiers
FT   CDS_pept        complement(228717..229274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0217"
FT                   /product="translation elongation factor P"
FT                   /note="KEGG: cth:Cthe_0847 elongation factor P; TIGRFAM:
FT                   translation elongation factor P; PFAM: Elongation factor P
FT                   ; Elongation factor KOW-like domain-containing protein;
FT                   Elongation factor P/YeiP protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25804"
FT                   /db_xref="GOA:E6U6S1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6S1"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ADU25804.1"
FT                   /translation="MLSAGDFRNGLTFDMDGNVFSIVEFQHVKPGKGAAFVRTKLKNVI
FT                   TGAVVEKTFNPTDKFPTAYIERKDMQYLYNDGDIYYLMDKESFEQLPINASDVGDSFKF
FT                   VKENMDVKVLSYKGKVFGIEPPTFVELEITETEPGLKGDTATNVTKPAKLETGTEIRVP
FT                   LFINEGDRIRVDTRTGEYMERA"
     atgctttcag caggcgattt tcggaacggt ttgacttttg acatggacgg caatgtgttt        60
     tccattgtag aattccagca cgtcaaaccg ggcaagggcg cggccttcgt gcgcaccaaa       120
     ctgaagaacg tcatcaccgg cgcggtggtg gaaaaaacgt tcaatcccac cgacaaattc       180
     cccacggcct atatcgaacg caaagacatg cagtatctct acaacgacgg cgacatctac       240
     tacctgatgg acaaggaaag ctttgagcag ctgcccatca acgccagtga tgtgggcgac       300
     agcttcaagt tcgtgaaaga gaacatggat gtcaaagtgc tttcctataa gggcaaagtg       360
     ttcggcatcg agccgccgac gtttgtcgag cttgagatca ccgagaccga acccggcctg       420
     aagggcgata cggccaccaa cgtgaccaag cccgccaaac tggagaccgg caccgaaatc       480
     cgcgtgcccc tgttcatcaa cgagggtgat aggatccgcg tagacacccg caccggcgag       540
     tatatggaac gcgcataa                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page