(data stored in ACNUC9435 zone)

EMBL: CP002400.PE22

CP002400.PE22        Location/Qualifiers
FT   CDS_pept        23867..25282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0022"
FT                   /product="RNA methylase, NOL1/NOP2/sun family"
FT                   /note="KEGG: hmo:HM1_1033 nol1/nop2/sun family putative RNA
FT                   methylase; TIGRFAM: RNA methylase, NOL1/NOP2/sun family;
FT                   PFAM: Fmu (Sun) domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25613"
FT                   /db_xref="GOA:E6U5E6"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR027391"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031340"
FT                   /db_xref="InterPro:IPR031341"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5E6"
FT                   /inference="protein motif:TFAM:TIGR00446"
FT                   /protein_id="ADU25613.1"
FT                   /translation="MAKRKARPPVPQAVPPAAFLARMRGLLGEADFAAFEAAQTAPVRR
FT                   GLRLNLLKCRDASAFARIAGFSLSPLPFSPEGFSVEGGDVSGRHPWHHAGVFYLQEPSA
FT                   MSAVTALDPRPGQRVLDLCAAPGGKSTQIAARLGGQGLLVANEIVPGRAKILLSNLERF
FT                   GVRNACVYNETPERLCAAFPGFFDAVLVDAPCSGEGMFRREPAAAAEWTPETPAACARR
FT                   QRAILDWAKTALRPGGVLVYSTCTFAPEENECVVAAFLKENPDFSMEPIPCAFGRPARP
FT                   DWGGGEPSLELARRIFPQDGGEGHFVARLRMGAGAAAGTARFHAQENGDGMDDAQADVL
FT                   LRAFFAEQFGEPPYGRPHAAGEVLFLLPEELPALPQGLRLLRAGVCAGRIKSGRFEPTH
FT                   ALYLAAAPGACRRAVDLPLGDARLAAFLHGEQIEADGAAGYIAVLAAGHAVGFGKASGG
FT                   VLKNHYPRALRTL"
     atggcaaagc gtaaggccag gccgccggtg ccgcaggccg ttccccctgc ggcgtttctt        60
     gcgcgtatgc gcggccttct tggtgaagca gactttgcgg cgtttgaagc ggcgcagacc       120
     gcaccggtgc ggcgcggtct gcggctcaat ctcctcaagt gccgggatgc gtccgcgttt       180
     gcccggattg ccggtttttc gctttcccct ctcccctttt cgcccgaggg gttttctgtt       240
     gagggcggcg atgtgagcgg gcggcatccc tggcaccacg cgggcgtgtt ttatctacag       300
     gagccgtcgg ccatgtcggc ggtgacggcg ctcgatccgc ggcctgggca acgcgtgctt       360
     gatctctgcg ccgcgccggg cggcaagtcc acccagatcg ccgcccggct gggtgggcag       420
     gggctgcttg ttgccaatga aatcgtgccg gggcgggcga agatcctgct ttccaatctg       480
     gaacgcttcg gggtgcgcaa cgcctgtgtg tacaatgaaa cgcccgaacg gctctgtgcg       540
     gcgtttcccg gttttttcga cgcggtgctg gtggacgcgc cctgttccgg cgagggtatg       600
     ttccggcggg agcctgccgc cgccgcggaa tggacgccgg agaccccggc tgcctgcgca       660
     agacggcagc gcgccattct ggactgggcc aaaacagccc tgcgccccgg cggcgtgctg       720
     gtctattcca cctgtacgtt cgcaccggag gaaaacgagt gcgtggtcgc cgcgtttttg       780
     aaagaaaacc ccgatttcag catggaaccc attccatgcg cgttcggccg cccggcgcgc       840
     ccggattggg ggggcggaga gccttcgctg gagctggccc gccgcatctt tccacaggac       900
     ggcggcgagg ggcattttgt ggcccgcctg cgcatgggcg ccggcgcggc ggcgggtaca       960
     gcccgtttcc atgctcaaga gaatggtgac ggaatggatg acgcacaggc ggacgttctg      1020
     ctgcgggcgt tttttgccga acagttcggc gagccgccgt atgggcggcc gcatgcggcg      1080
     ggcgaggtgc tgtttttact gccggaagag ctgccggcgt tgccgcaggg cctgcgtctg      1140
     ctgcgcgcgg gagtctgcgc cgggcgtatc aaaagcgggc ggttcgaacc gacgcacgcg      1200
     ctctatctgg cggctgcgcc gggcgcgtgc cgcagggcag tcgatctgcc gcttggcgat      1260
     gcgcgtctgg cggcgtttct gcatggcgag cagatagagg cggacggagc tgccgggtat      1320
     atcgccgtgt tggcggccgg gcatgccgtg gggtttggca aggcgtccgg cggggtgttg      1380
     aaaaaccatt atccccgtgc gcttcgtacc ctgtga                                1416
//

If you have problems or comments...

PBIL Back to PBIL home page