(data stored in ACNUC9435 zone)

EMBL: CP002400.PE224

CP002400.PE224       Location/Qualifiers
FT   CDS_pept        238085..238798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0228"
FT                   /product="protein of unknown function UPF0016"
FT                   /note="PFAM: protein of unknown function UPF0016; KEGG:
FT                   ckr:CKR_3028 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25815"
FT                   /db_xref="GOA:E6U6T2"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:E6U6T2"
FT                   /inference="protein motif:PFAM:PF01169"
FT                   /protein_id="ADU25815.1"
FT                   /translation="MPVLISLSALTPFLTAAAFVLLNELGDKSQLLTIAFASRMRVGKV
FT                   LFGVLIATLANHGLAVAVGTLLAHVPGWDGWVRFLAAVLFLFFGLAALRPDISAEKRSP
FT                   PQSRLGDVATVAFAFFFAEMGDKTQLATVALAARFPDAPLLVLAGAAAGMLLADGIGIT
FT                   AGVLLHRKLSANVCRVVAAVTFVLFGLFGIYEGLTGLLGFSGAGAAVVTVLAAACTLTA
FT                   GICLRKPGRKRTGRA"
     atgcctgttt tgatcagttt gtctgcactc acgccgtttc tgacggcggc cgctttcgtg        60
     ctcctcaacg aattggggga caagagccaa ctgctcacca ttgcgtttgc cagccggatg       120
     cgtgtgggaa aggtgctgtt tggcgtcctc atcgctacgc tggccaacca tgggctggcg       180
     gtggcggtgg gcacgctgct ggcgcatgtg ccgggatggg acggatgggt gcggtttctg       240
     gccgccgtgc tgttcctctt ttttggcctg gcggcgctgc gaccggacat ttccgccgaa       300
     aaacgctcgc ccccacagag ccggctgggt gatgtagcca ctgtggcgtt cgcctttttc       360
     ttcgcggaaa tgggcgacaa gacccaactg gccaccgttg cgttggcggc acggtttccc       420
     gacgcgccgc ttttggtgct ggcgggcgcg gcggcgggca tgctgctggc ggacggcatc       480
     ggcatcacgg cgggtgtgct gctccaccgt aaactttcgg caaatgtctg ccgggtggtc       540
     gccgcggtca cattcgtgct gttcggcctg ttcggcattt atgagggcct caccgggctg       600
     cttggttttt cgggcgccgg ggcggctgtc gtcaccgtgc tggccgccgc ctgcacgctg       660
     accgccggca tctgcctgcg caagccgggc agaaagcgga ccggccgcgc gtga             714
//

If you have problems or comments...

PBIL Back to PBIL home page