(data stored in ACNUC9435 zone)

EMBL: CP002400.PE227

CP002400.PE227       Location/Qualifiers
FT   CDS_pept        complement(242022..242630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0231"
FT                   /product="Pyruvate/ketoisovalerate oxidoreductase,
FT                   catalytic domain"
FT                   /note="PFAM: Pyruvate/ketoisovalerate oxidoreductase,
FT                   catalytic domain; KEGG: ccu:Ccur_07880 2-oxoacid:ferredoxin
FT                   oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25818"
FT                   /db_xref="GOA:E6U783"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:E6U783"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ADU25818.1"
FT                   /translation="MMATTTSERVDTPVTAGNGAQAKPYSMTTLFAGFGGQGILFSGKV
FT                   MAYAGLLEGREVSWLPSYGPEMRGGTANCGVCISSNPVGSPLVTDPDAFVVMNLPSFLK
FT                   YIDHVRPGGVAVLDSFLIDRKVERNDIRAFYIPATRLASENKIDGLANMIMLGKLLRET
FT                   QFAAYDSVIAGLRKSVPARKAALVDANIKAIGIGMEYNK"
     atgatggcga cgaccacttc cgaacgagtc gatacgccgg tcacggcggg taatggcgcg        60
     caggcgaagc cgtattccat gaccacgctg tttgccgggt tcggcgggca gggcatcctg       120
     ttttccggca aggtgatggc gtatgccggc ctgctggagg ggcgcgaagt gtcatggctg       180
     ccctcttatg gaccggaaat gcgcggcgga accgccaact gcggggtgtg catctcgagt       240
     aatccggtgg gttccccgct ggtgactgat ccggacgcgt tcgtggtgat gaacctgcct       300
     tcattcctaa aatacatcga ccatgtgcgg ccgggcggcg ttgcggtgct ggattcgttc       360
     ctcatcgacc ggaaagtgga gcgcaacgat atccgcgcgt tttacattcc cgccacccgg       420
     ctggccagcg agaacaagat cgacggcctg gcgaatatga tcatgctggg caagctgctg       480
     cgcgaaacgc agtttgcggc gtatgattcc gtgatcgcgg ggctgcgcaa gtctgtgccc       540
     gcgcgcaagg ccgcgctggt ggacgcaaat atcaaggcca tcggcattgg aatggaatat       600
     aacaaatag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page