(data stored in ACNUC9435 zone)

EMBL: CP002400.PE231

CP002400.PE231       Location/Qualifiers
FT   CDS_pept        complement(244758..245420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0235"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ele:Elen_1707 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25822"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E6U787"
FT                   /inference="similar to AA sequence:KEGG:Elen_1707"
FT                   /protein_id="ADU25822.1"
FT                   /translation="MLQSRLQIITGHYGSGKTTFAVNLAMENARAGRKTCLVDMDIVNP
FT                   YFRAADSKGPLEAAGVRVIRPIYAGTNLDLPALPGELAAVFDDTSYTVVLDVGGDDAGA
FT                   AALGAYAHRILAADYAHLYVFNARRPLTSTPEEAVQILREIEAVSRVPATGLVNNTNLG
FT                   NETDTDVPAASAAFAEQTAALTGLPLIYTGVRQELADAARSRLPSVYPLTMWVVPPW"
     atgctccaaa gccgattgca aatcatcacc gggcattatg gcagcggcaa aacaactttt        60
     gccgtcaacc tcgcgatgga aaatgcccgc gcggggcgga agacctgtct ggtggatatg       120
     gatatcgtca acccgtattt ccgtgcggcg gacagcaaag gtccgcttga agccgcaggc       180
     gtgcgggtta ttcggcccat ctacgcgggc accaatctcg acctgcccgc gctgcccggg       240
     gaactggctg ccgtgtttga cgacacgtct tataccgtgg tgctggatgt cgggggggac       300
     gacgcgggcg ccgcggcgct tggcgcgtat gcgcaccgta tcttggcggc ggactatgcg       360
     catctgtatg tgttcaatgc ccgccgcccg ctcacatcca cacccgaaga agcagtgcag       420
     atcctgcggg agatcgaggc ggtttcgcgc gtgcccgcca ccggcctggt gaacaacacc       480
     aatctgggga acgagaccga cacggatgtg ccggccgcat ccgcggcatt tgcggagcag       540
     acggcggcac tcacaggcct gccgcttata tacaccggcg tgcggcaaga gctggccgac       600
     gccgcacgct cccgtctgcc ctcggtttat ccactgacca tgtgggtcgt gcccccgtgg       660
     tga                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page