(data stored in ACNUC9435 zone)

EMBL: CP002400.PE245

CP002400.PE245       Location/Qualifiers
FT   CDS_pept        262243..262929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0249"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="KEGG: cth:Cthe_1600 two component transcriptional
FT                   regulator; PFAM: response regulator receiver;
FT                   transcriptional regulator domain-containing protein; SMART:
FT                   response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25836"
FT                   /db_xref="GOA:E6U7A1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ADU25836.1"
FT                   /translation="MSKTAFVVEDEENIREVIKCALESCGLRVKGFEEAELLFEEMEKV
FT                   LPDLILLDIMLPGMDGLSALRQIKAGPAAHVPVILLTAKSSEIDKVTGLDLGADDYVTK
FT                   PFGVLELMARVRAALRHAGQAGSDRSVLIARGIRLDKERHEVTLHEKAVELTLKEFELL
FT                   KLLMENEGKAMTRNILLDNVWGYGYAGETRTLDMHVRSLRQKLGIDETGGHYITTVRGV
FT                   GYKFDS"
     atgtctaaaa cggcatttgt ggtagaagat gaagaaaata tacgagaagt aattaagtgc        60
     gcgctggagt cctgcggtct gcgggtcaaa ggattcgagg aagcggaatt gctttttgaa       120
     gaaatggaaa aagtcctgcc ggacctgatc cttctggata tcatgctgcc cggcatggac       180
     ggtctttccg cattgcggca gatcaaagcg ggacctgcgg cgcatgtgcc ggtcatcctg       240
     ctcacagcca aaagcagcga gattgataaa gtgacggggc tggacctggg ggcggacgat       300
     tatgtcacca aaccgttcgg tgtattggaa ctgatggcaa gggtgcgcgc cgcactgcgg       360
     catgcggggc aggccggctc ggaccgcagt gtgctgatag cgcgcggcat acggctggac       420
     aaagagcgcc acgaggtcac tttgcacgaa aaagcggtcg aactgaccct gaaggaattt       480
     gagctgctca agctgctgat ggaaaacgaa ggaaaggcca tgacacgcaa tatcctgctg       540
     gacaatgtgt ggggctatgg atatgcaggt gagacgcgca cgctggatat gcatgtgcgg       600
     agcctgcgcc aaaaactggg tatcgatgag accggcggac attatattac cacggtgcgc       660
     ggcgtcggat acaaattcga cagttga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page