(data stored in ACNUC9435 zone)

EMBL: CP002400.PE253

CP002400.PE253       Location/Qualifiers
FT   CDS_pept        269470..269910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0257"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: dae:Dtox_4132 GtrA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25844"
FT                   /db_xref="GOA:E6U7A9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7A9"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ADU25844.1"
FT                   /translation="MASFKKIVSAFRKRYPTLYQLAGFCAVGASGLLVMMAAYYLFLAF
FT                   HADKQVANLAGFSASTAYAYLMNFVFVFQAKTVPPKRAAVKFFALYIALYFFSAYMVHV
FT                   FTDLLHISVLLIPILNSILITPPSFLGSKYWVFREKEKSLGA"
     atggcatctt tcaaaaaaat agtttccgct ttcagaaagc gttatcccac gttgtaccag        60
     cttgccgggt tctgcgccgt tggtgccagc gggctgttgg tcatgatggc agcctactat       120
     ctgtttctgg ccttccacgc agacaagcag gtggccaatc tggccggttt ctcggcaagc       180
     acggcttatg cctacctgat gaacttcgtg tttgtatttc aggccaaaac cgtgccgcct       240
     aaacgcgccg ctgtaaaatt cttcgcgctg tatattgctc tctatttttt cagcgcatat       300
     atggttcatg tcttcacaga cctgctgcat atcagcgtgc tgctcattcc cattctgaac       360
     tccattctca tcaccccgcc cagctttctg gggagcaaat actgggtgtt ccgcgaaaag       420
     gaaaaatcgc ttggggcata g                                                 441
//

If you have problems or comments...

PBIL Back to PBIL home page