(data stored in ACNUC9435 zone)

EMBL: CP002400.PE260

CP002400.PE260       Location/Qualifiers
FT   CDS_pept        complement(276117..278432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0265"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   lgs:LEGAS_0445 ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25851"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B6"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ADU25851.1"
FT                   /translation="MYLMKARSLKVKLVMIGAIVFVASTIFTTCLTFISGVNGYVSQYY
FT                   SGHQTADLFFNTADPQKAKTILDSCTDTDYVSAYKQYQGYRVSNAVTVNGNSIDPGYLY
FT                   AFSFQDTKDLPWQMEVLQANGSTTAPPKGDIWISQLFADQYHVKLNDTIQLYPGHSVQL
FT                   KVAAIVNNALTPSALLGIDYFYLNRDDMTQLGSFRAVNLIAVQAKASVSKTKKHLLSTV
FT                   DNQVGGILLDKGTLIQSATMLSSIVGGVGLLASVLILISVLFSIAFILKSILKKEYKQL
FT                   GVLKSLGRTNREVRRIYYLPFLLVNTAAVLVGCGVSVIISNTLIHIILRYIGDYTFSAI
FT                   AVFVTALCFLALAAIIAVFTILVTRPVNKIIPAEAFRNTNTAAVDSKLTVVKSSSSAFA
FT                   MAINDMFKYSHVSLLLVIVFCISFYLTFLFFNINYSVSRINENASKWFSTPQSDLVITG
FT                   NLFSSDGKDEVLQTIQNSSDVKSYIYGDIITGANVGLNKQKYDLKSSNMSITVMNDFNS
FT                   QFQFSILAGHNPEHVDEVAVGNNILRDTGLHVGDRISLLFNNQEHDMKIVGSYITLLNN
FT                   GYNIKILHDTLSKYDVPANETAICVRLKNTADFDRVKQSILQTYPGVSVNAALPDISNT
FT                   VSTVSDIVTPVTLILIVAILFFSLLNVVMITIITNTDQRKNFGIMKALGFSSGYIMARN
FT                   LARIAVLSAAGLVFAFLFNAFFSAKLFAFALGGVDGFLNSIAGTLILSGAIIASILAAG
FT                   FFSGLSVFSVSPRELFDE"
     atgtatttga tgaaagcccg aagtttgaaa gtaaaactcg tgatgatcgg cgcaatcgtt        60
     ttcgtcgcct ccaccatttt tacaacgtgc ctgaccttta tctccggtgt caacggctat       120
     gtcagtcagt attattccgg ccatcagacg gcggatcttt ttttcaatac cgccgacccg       180
     caaaaggcaa aaaccatcct ggacagttgc accgacaccg attatgtatc ggcgtacaag       240
     caatatcagg gatatcgtgt ttcaaacgcc gtgacagtaa acggcaacag cattgacccc       300
     ggctatctct acgcattttc ctttcaggac acaaaagatc tgccatggca gatggaggta       360
     ctgcaggcaa acggcagcac caccgcaccc ccaaaagggg atatctggat ttcacagctg       420
     tttgcggatc aataccatgt caaattgaac gatacgatcc agttgtaccc ggggcattcc       480
     gttcagttga aagtggctgc aatcgtcaac aatgcgctga cgccctccgc cttgctgggc       540
     atcgactatt tttatctgaa cagggatgac atgacgcaat taggcagctt ccgggccgtc       600
     aatctgatcg cggtgcaggc gaaggcatcg gtttccaaaa cgaaaaagca cctgctcagc       660
     accgttgaca atcaggtggg cggcatcctg cttgataagg gcactcttat tcagtccgcc       720
     accatgctga gcagtatcgt tggcggcgtc ggcctgctgg cctccgtcct gatactgatt       780
     tccgttttgt tttccatcgc ttttatatta aaaagcattc taaaaaaaga atacaagcag       840
     ctgggtgtat tgaaatccct aggcaggacc aaccgcgagg taaggcgcat ctattatctt       900
     ccgttcctgc tggtcaacac agccgccgtc ctggtcggct gcggcgtcag cgtcatcatt       960
     tcaaacacgc tgattcatat cattctgcgt tatatcggcg attacacatt cagcgccatc      1020
     gcggtgtttg taacggcgct ttgttttctg gcgctggcgg cgattattgc agtgtttacc      1080
     atattggtca cacgaccggt caacaaaatc attccggcgg aggccttccg gaatacaaac      1140
     acggcagcag tcgattccaa gttgaccgtt gtcaaaagct cctcgtcggc gtttgcgatg      1200
     gcaattaacg acatgttcaa atacagccat gtttccctgt tgctggtcat tgtgttctgc      1260
     atttcttttt acctgacgtt tttatttttc aatatcaatt attcggtttc cagaatcaat      1320
     gaaaacgcct caaaatggtt ctccactccg caatccgatt tggtcatcac cggcaacctt      1380
     ttttcctccg acgggaaaga cgaggttctg caaaccattc aaaacagcag tgatgtgaag      1440
     agctatattt acggggatat catcaccggc gcgaacgtcg gcctgaacaa acaaaaatat      1500
     gacctcaaaa gctccaacat gagcatcacg gtgatgaacg atttcaattc acaattccag      1560
     ttttcaatct tggcggggca taacccggag catgtggacg aagtcgcggt cggcaacaat      1620
     attctgcggg acaccgggct gcatgtgggc gaccggatca gcctgctgtt caacaatcag      1680
     gaacacgata tgaaaatcgt cggttcctac atcacactgt tgaacaacgg gtataacatt      1740
     aaaattctgc atgacacact cagcaaatac gatgtgcctg caaacgaaac cgccatttgc      1800
     gtccggttga aaaacaccgc tgactttgac cgcgtgaagc aatccattct acagacatat      1860
     cccggcgtgt cggtcaatgc cgcgctaccc gatatcagca ataccgtttc caccgtttcg      1920
     gatatcgtga cgcccgtcac gctcattctg atcgtggcaa tcctcttttt cagccttctc      1980
     aacgtggtga tgataacgat cattaccaat accgaccagc ggaaaaactt cggcattatg      2040
     aaggcactgg gcttttcttc cggctatatc atggcccgca atctggcgcg gatcgctgtt      2100
     ttgtcggcag cgggtctggt gtttgccttc ctgttcaacg catttttttc cgcaaagcta      2160
     ttcgcatttg ccctgggcgg ggtggatggg tttcttaatt ccatagccgg cacgcttatt      2220
     ttgtccggcg ccatcatagc ttccattctg gcggccggtt tcttcagcgg cttgtcggtg      2280
     ttttccgttt cgcccagaga gctgtttgat gaataa                                2316
//

If you have problems or comments...

PBIL Back to PBIL home page