(data stored in ACNUC9435 zone)

EMBL: CP002400.PE262

CP002400.PE262       Location/Qualifiers
FT   CDS_pept        complement(279724..291444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0267"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="KEGG: cbe:Cbei_0250 amino acid adenylation
FT                   domain-containing protein; TIGRFAM: amino acid adenylation
FT                   domain protein; SagB-type dehydrogenase domain; PFAM:
FT                   AMP-dependent synthetase and ligase; Beta-ketoacyl synthase
FT                   ; KR domain protein; phosphopantetheine-binding;
FT                   condensation domain protein; Non-ribosomal peptide
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25853"
FT                   /db_xref="GOA:E6U7B8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR013968"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020051"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7B8"
FT                   /inference="protein motif:TFAM:TIGR01733"
FT                   /protein_id="ADU25853.1"
FT                   /translation="MKEIYKQIAQMIKDGKIDKGSAALLLKQLRTEEKIRSRAIAVIGM
FT                   ALHFPHADTPDAFWNVLQNGMDCITAFPKNREAQISHYVSSVFHLDEPDYQSGGFLGHI
FT                   DRFDDSFFHISPREAELMDPNQRLLLQTAVEAMEDAGYGGTQLDNTKTGVYIGYANVLK
FT                   DSYQNIIFHERPDLIPQSIINNLSAELPSRIAYLLNLKGPTMVIDTACSSSLVCIHTAC
FT                   RAILNGDCEQALAGGIKLQLVPVNHESYRVGVETESGRTRTFDDQADGACMGEGVAVVF
FT                   LKPLEKAVSDGDHVYAVVKGSAINQDGSTIGITAPNPEAQAEVLAAAWQNAGINPEALD
FT                   YIVSHGTGTRLGDPVELKGIRAAFRRYTDKKQFCAIGSVKPNVGHLFECSGVANLIAGI
FT                   LALRHQQIPPSLHFQHPNRTVGFCGGPVYVNTKLRDWNVETGEKRLCGINSFGLSGTNC
FT                   HVVLEEAPEPVAVACGATEGPRVFTLSAKSRASLSALLDSYRRFFADGTAPFDAACYTS
FT                   NVGRGHYGYRIALLADDMRDLLRKMDRISAGAPGSVPDSGLFYGYHQLVPAGVHDAGTV
FT                   TEAEIARQDELGRVLVERLAAEPGQENGAVLYRQLCELYVQGAHIDWRPLYPEDARRKI
FT                   PLPAYCFDGRPCWIPANPQAKSHSDGFFSVRWTPKPIAPTAQAGSAVLVFAREESPAAQ
FT                   QIVRDLSDAGKTVTLIVRGDGAQQAEKTSANHLFAAPGDRARYETIFRETAPSHILLLL
FT                   SPPEDDTAQAAGLSVLLSLVQAIGREAAVQLLLLGDYVYPVTGDEPYRHPQNAPLFGFL
FT                   KGVEREYRNIRCRAIDADTDFDTTRLLEEMAAPDELPVIAYRGGRRYAEQLTESAPERY
FT                   PASGMQIRDGGVYLITGGTGGIGLEMARFLAEKKRIVLILAGRTALPNRSEWDALAEHP
FT                   DTGAPGEKIRRIRALERTGAHVLTECMDVSDPAAVRACLSRVKSAFGRLDGVIHAAGIA
FT                   GNALLEDETLHNTLSVLKPKVSGAMNLLHAVQDEPLDFCLFFSSIATVLPAPGQAGYIA
FT                   ANAFLDACAGMKAGKSAVVKVINWSTWKETGMAFRHHVNMDTIFESLPTETALAYFDAV
FT                   WDRAFDRLLIGRPNPKLMFLMEKEPILLSETIDRGHVNREAAAAVQTVRPVLARANVQG
FT                   APELLGKSSDAYTPTEQKLAGYLYSTLGFDRVNVYDNFFEMGMDSISIVRLTDEIKKDF
FT                   QISLAFSVFLDNPTIYNVAKAIDVGAGVRTEKPDTVVPPSGHGDHFQAFPLSKVQASYL
FT                   FGREKKYELGGIATHAYMEIRTERDIPRLNRALRKLIERHDMLRAVILPDGTQKFLESC
FT                   PDYSIRCDDLSGLGAEEAGRHVQALRDRMSHRVYLAGEWPLFEIRACRMDHNTNLLFIS
FT                   IDMLIADAVSLEIIINELTEYYEDETLSLPQLQYSFRDYQITLARQADSPEYARDKAYW
FT                   LERLELFPDAPRLPYRTALSAISHVRFRRLEHLFSKQETDRVNELAHRHGVTLSAALCC
FT                   AYAFILSLYCNQRSLAINLATFNRKQLHPEVDQLVGDFTSVILLATELDFDRDFWANAQ
FT                   RLQSTMMEGLEHRLYEGVEFIGELAQKNGTPNAAVMPVVFTSMLYQGAGSSIGKLGQIT
FT                   YAISQTSQVVLDNQVREVDGALQFNWDYVESAFEPQEIEKIFDGYISYIQSVAAGRIDA
FT                   PVLNEDDRRLIEAYNHTEWACAPASPAELFEKQAAARPEATAVICEGERITYGDLDARS
FT                   NRLANYLKSHGVSRGNTVGILSARQIETIVNILAVLKCRAAYVPIDPGYPKSRCDYILE
FT                   NSCADLLIETDFYKEHDVGQYPADRLPEACVPDDVAYLIYTSGSTGKPKGVIISNKSAC
FT                   NTVLDMNRRFHVTERDIFLGISSLCFDLSVYDVFGALSCGGALVMVPDQHDIGHLIETV
FT                   AQQRVTIWNSVPAIMNLAVEFCENDPDARLSSLRLVLLSGDWIPLKLPDRIRRHAPDAQ
FT                   TISLGGATEGSIWSIYYPIDAVDAGWRSIPYGMPLANQTIYIVSGDGRLCPVATPGEIC
FT                   IGGIGVANGYANNEAQTTASFIAHPQLGRLYKTGDFGILTSAGYVEFLGRRDAQVKING
FT                   YRVELSEVEKCIEGLAGVEAAKAVVLQGKGGSHVIGAFVKAGRDVTAQAVQQHAAAHLP
FT                   RYMVPTTISILEAFPLTFNGKVDVKKLSATVEPEQQTVRETGASNQTEERLIRIFKETL
FT                   HLEAVGIHTSFFDMGVNSIQIIQIANKIHTVFNKKIAFKDFIDKENISELASLLQDTEQ
FT                   AAEDEVTYRSVAPDLANLNEPFPLTQVQTAYLMGREKIFELGGVSTHGYAEMENALEPD
FT                   RLNAALEKLIARHPMMRMVILENGMQQILKYVPKYRIEVVDLRGLPDEEKQQRLMDERA
FT                   RMSHYIFDPGKWPLFDLRIYRLENAKNAMFVGYDLLMADGMSIQVISRELMAYYEHPDT
FT                   DLHPIFFSFRDYVLALEDFKQNSKTYQSDRAYWLEKLEDFPFSPALPLKMPPSEVEQPH
FT                   FRRLSKVFGQRDWSRIKEFAASQSVTPSSLICSIYAKVLAFWSNSNRFALNLTVFNRYP
FT                   FHEDVNAVIGDFTSVLLLDISLNPGHTLVETAQQTQKTIMSALQHRHYEGVDFIRDIAK
FT                   RYNLERKAIMPVVFTSMIFGEMDHPEPYRSKLGKIEMSVSQTSQVYLDNQVSDSGNQLT
FT                   ITWDYVEELFDPDVVAKMFDQYTGMLTQILEGPVTGSIGVDQDAFRQILDYNQTQKPMT
FT                   ETTLAELMERQAALHAEQIAVMCEGISVSYGELSRKSNRIARYLKSKGIARGAFVGVLT
FT                   ARRIESVANILGVLKAGAAYVPINPDYPQKRREYMYDNCGCSLLLVPDTYEEEQLERLD
FT                   DSAMLDGRPEDVAYVIHTSGSTGNPKGVVISNQAACNTILDINEKFGVSGQDRILGISS
FT                   MCFDLSVYDLFGAFAAGATLVIVPDQRDIAHLLELVEREKITVWNSVPAIMELAVGQLN
FT                   RETGAEPPRMVQAAARPSAMAPRENELYYWSPAVHWTERDGHIMAGDYVCPDEMAKLMP
FT                   AFYFRAQAGATLAELAQLYGAQSDSFPHFLKELTEHRVLVNSILPPDEIFAQQNKMFVN
FT                   PYAEDIIYNYEANLRFKEEQLNRTVVRGGKPVTFPNRYQYPPSIANRRSVRDYDTERPV
FT                   PFDTLCAFLSVMHQNVEDRHYQYYYASAGGLYPIDIYLHVKPGRVENLEQGIYYYNPVA
FT                   NSLQLVEPNPTLTEAAHYYTNKKIFKSSAFSVFFLYNAGANMPKYAGKGYFYAILDAGI
FT                   LAATLTHTAELIHLGTCSIGDMMFRKVEADFHLNCNQVWVHTMEVGLKKAENGTAPEMI
FT                   ETITVNRLESGPAEQTVEQKTEETPSFRAGQWDAASLRLVLLSGDWIPLHLAGQIKTAC
FT                   PNAQIISLGGATEASIWSIYYPIRAVKTEWSSIPYGMPLANQTIYIMGLDEELCPIGTP
FT                   GEIMIGGAGVAEAYINDEQKTQAAFVVHPKLGRLYKTGDYGIFRPEGYVEFLGRKDSQI
FT                   EIGGHRIELGEITANLEQNPNTAKCVSVPYTDTNGIEQICSYVVLKNAVLISELRAYLK
FT                   ERLPDYMVPARILEVNEIPLTDNGKLNTKALPDPRLFGRETASYEGPSTEIEQKLEAIV
FT                   AQYVGTGKVSVTDDIFEAVGNSVILIQMHQEIDRMYPGIVKVVDLFNRPTIRQIAAFIQ
FT                   ETSAQRHKRRYPPICLPENWFVPKNVAKPCQADIAIRESQYAALARAARHFSTPIGTLV
FT                   FISFAYALAGMTAQETLHLPGVINRTNQMELFEIDFSGKSSFSELLEDQQAVKIVQTGP
FT                   FTNRADDWVDKGKYAIVPLVYNKSLLNSNVALSEQYDLCLAFDENSGTRELSAEIRSSR
FT                   LAPEKLRSLVGVLGKTLELLTKETAL"
     atgaaggaaa tctataagca aattgcgcag atgataaagg atggcaaaat tgacaagggc        60
     agcgcggcct tgcttttgaa gcagcttcgc accgaggaga aaatccggag ccgggcaatt       120
     gccgtcatcg gcatggcgct gcattttccc catgccgata ccccggacgc attctggaac       180
     gttctgcaaa acggcatgga ctgcatcacg gcatttccga aaaacagaga agcgcagatt       240
     tcacactatg tctccagcgt gttccatctg gacgagccgg attatcagtc gggtggattt       300
     ctcggccaca tcgaccggtt cgacgattcg ttttttcata tctcccccag ggaagcggaa       360
     ctgatggacc ccaaccagag gctgctgctg caaaccgccg tggaggccat ggaggacgcc       420
     gggtatggcg gcacgcaact ggacaacacg aagaccggcg tctacatcgg ctacgcaaac       480
     gtgctgaagg acagctatca gaacatcatt ttccatgaac ggcccgacct gatcccgcag       540
     tcgatcatca acaacctgtc ggccgagttg cccagccgca tcgcgtatct gctcaacctg       600
     aagggcccga cgatggtaat cgacaccgcc tgctcgtcgt cgctggtgtg catccacacc       660
     gcctgccggg ctatcctgaa cggggactgc gagcaggcgc tggccggcgg catcaagctg       720
     caactcgtgc cggtgaacca cgaatcttac cgggtcggcg tggagaccga aagcggacgc       780
     acgcggacgt ttgacgatca ggcggacggc gcctgcatgg gcgagggcgt ggccgttgtt       840
     ttcctcaagc cgctggaaaa ggccgtgtcg gacggcgacc acgtttacgc ggtcgtcaag       900
     ggcagcgcca tcaaccagga cggcagcacc atcggcatca ccgcacccaa cccggaggcg       960
     caggcggagg tgctcgcggc ggcgtggcaa aacgccggca tcaatccgga agcgctggat      1020
     tatattgttt cgcacggcac cggcaccagg ctcggcgacc ctgtggagct caaggggatc      1080
     cgcgccgcct ttcggcgcta taccgacaaa aagcagtttt gcgccatcgg ctccgttaaa      1140
     ccgaacgtag gccacttgtt tgaatgctcc ggcgttgcaa acctgatcgc cggcattctg      1200
     gccctccggc accaacagat ccccccaagc ctccacttcc agcacccgaa ccgcacggtc      1260
     gggttttgcg gcgggccggt gtatgtgaac acgaagctgc gtgactggaa tgtggaaacc      1320
     ggggaaaaac ggctttgcgg catcaattcg tttggattga gcggaaccaa ctgccatgtc      1380
     gtgctggagg aagcgccgga acccgtcgct gttgcgtgcg gggcgaccga aggcccccgc      1440
     gttttcaccc tgtcggccaa gagccgtgcc tccctttccg cactgctgga cagctaccgg      1500
     cgcttctttg cggacggaac ggctccgttc gacgcggcct gctacacctc caacgtcggg      1560
     cgtggacatt acgggtaccg aattgctctg ctcgcggacg acatgcggga tctgctgcga      1620
     aaaatggatc gcatatccgc cggcgcgccg gggtccgtgc cggacagcgg cttgttttac      1680
     ggctatcatc agcttgtacc cgcgggcgta cacgacgcgg gtacggtgac cgaagcggaa      1740
     atagcgcggc aggacgaact tggccgggtg ctcgtggagc gcctggcggc cgaacccggc      1800
     caggaaaacg gcgccgtgct ctaccggcag ctttgcgagc tgtacgtaca aggtgcccac      1860
     atcgactggc gtccgcttta tccggaggac gcccgccgga aaatcccgtt gcccgcctat      1920
     tgtttcgacg gccgcccgtg ctggatcccg gcgaatccac aggccaaaag ccacagcgac      1980
     ggttttttct ccgtgcggtg gacgccaaag cccatcgcgc cgaccgcgca ggccggcagc      2040
     gccgtcctgg tgttcgcacg ggaagaaagc ccggcggcac agcagatcgt gcgggatttg      2100
     tctgacgccg ggaagacggt caccctgatc gtgcggggcg acggggcgca gcaggcggag      2160
     aaaacgtctg ccaaccacct tttcgcggca cccggcgacc gcgcgcgtta tgaaacgatt      2220
     ttcagggaga ccgcaccctc ccatatcctg ctgctccttt ccccgccgga agacgacaca      2280
     gcacaggcgg ccggcctgtc tgttctgctg agcctggtgc aggccatcgg gcgggaagcg      2340
     gccgttcaac tgctcttact gggcgactat gtttatcccg tcaccgggga cgaaccgtat      2400
     cggcacccgc agaacgcacc gcttttcgga ttcctgaaag gggtggagcg ggaatatcgg      2460
     aacatccgct gccgtgccat cgatgccgac acggattttg acaccaccag gctgctggag      2520
     gaaatggcgg ccccggatga gttgccggtc attgcctacc gcggcggcag gcgctacgcg      2580
     gaacagttga cggaaagcgc ccccgagcgg tacccggcct ccggtatgca gatccgggac      2640
     ggcggcgtct atctgatcac aggcggcacc ggtgggatcg gcctggaaat ggcacgcttt      2700
     cttgccgaaa agaagcgcat cgtgcttatt ctggctgggc gaacggcttt gccgaaccgt      2760
     tcggaatggg atgcactggc ggagcacccg gacaccggcg cgcccggcga aaagatcaga      2820
     cgcatccggg cgctggaacg aaccggtgcg catgtcctga cggagtgcat ggatgtttcc      2880
     gacccggcgg cagtacgggc ctgcctgagc cgcgtcaagt cggcgtttgg gcggctagac      2940
     ggcgttatcc acgctgcggg catcgccggc aatgctctgc ttgaggacga gacactgcac      3000
     aatacgctca gtgtactcaa gcccaaggta tccggtgcca tgaacctgct gcacgccgtt      3060
     caggacgaac cgctggactt ttgcctgttc ttttcgtcga ttgccacagt gttgccggca      3120
     cccggacagg cgggctacat cgcggcgaat gcgtttctcg atgcctgcgc ggggatgaag      3180
     gccggcaaaa gcgcagtcgt aaaggtcatc aactggagca cctggaaaga aaccggcatg      3240
     gcgttccgcc accatgtgaa catggataca atttttgaat cgctgcccac cgaaacggcg      3300
     ctggcgtatt tcgacgcggt ctgggacagg gcgtttgacc ggctgttgat cggcagaccc      3360
     aaccccaaac tcatgttttt aatggagaaa gagcccatcc tgctctccga aacgatcgac      3420
     cgcgggcacg tgaatcgcga ggccgccgcg gctgtgcaga cggtgcggcc tgtccttgcg      3480
     cgtgcaaacg tgcagggagc accggagttg ctcggaaaat cgtccgatgc gtacacgccc      3540
     accgagcaga agctcgctgg atacctgtac agcaccctcg gttttgaccg cgtgaatgtg      3600
     tacgataact tttttgagat gggtatggac tccatctcca ttgtccgcct gacggatgag      3660
     atcaaaaaag attttcaaat cagcctggcg ttttccgtct ttctggacaa tccaaccatc      3720
     tacaatgtgg caaaagccat tgatgtcggc gcgggcgtcc ggacggagaa accggacacc      3780
     gtggttcctc cgtccggaca cggcgaccat ttccaggcgt tcccgctgag caaggtacag      3840
     gcttcctatc tgttcggcag agaaaaaaag tacgagctgg gcggcatcgc cacacacgca      3900
     tacatggaaa tccggaccga gcgcgatatt ccacgcctaa accgggcgct gcgcaagctg      3960
     atcgagcgcc acgacatgct tcgggcggtc atcctgccgg acggcacaca gaaattcctc      4020
     gaatcctgcc cggactacag catccgttgc gacgatctgt cgggtttggg cgcggaggag      4080
     gccggccggc atgtccaggc cctgcgcgac cgcatgtcgc accgcgttta ccttgccggt      4140
     gaatggccgc tttttgagat ccgggcctgc cggatggacc acaacaccaa cctgcttttt      4200
     atcagcatcg acatgctgat tgccgatgcg gtcagcctcg aaatcatcat caacgagcta      4260
     accgaatatt atgaagacga aaccctctcc cttccgcagc tccagtattc gttccgggat      4320
     taccagatta cgctcgcccg gcaggcggac tcgccggaat atgcccgcga caaagcatat      4380
     tggctggagc ggctggaact ttttccggat gctccgcggc tgccataccg cacggcgctg      4440
     tccgcgatca gccatgtgcg gttccgccgt ttggaacatc tgttctcaaa gcaggaaacc      4500
     gaccgcgtaa atgagctggc ccaccggcac ggcgtaacgc tttcggcggc gctgtgctgc      4560
     gcgtacgcgt tcatactttc gctgtattgc aaccagcggt cgctggcgat caatctggcc      4620
     acctttaacc gaaagcagct ccatccggag gttgaccaac tggtcggaga cttcacgtcg      4680
     gtcattctgc tcgcgacgga gctggatttt gaccgggatt tctgggccaa cgcccagcgc      4740
     ctgcagtcca ccatgatgga aggactggag cacaggcttt atgagggcgt cgagtttatc      4800
     ggtgagcttg cccaaaaaaa cgggacgccc aacgccgcgg tcatgccggt cgtgtttacc      4860
     agtatgctgt atcaaggcgc cggttcttcc attggaaaac tgggccaaat cacgtatgcc      4920
     atcagccaga cctctcaggt cgtcctggat aaccaggtac gggaagtcga cggcgcactg      4980
     cagttcaact gggactatgt ggaaagcgca tttgaaccgc aggaaatcga aaaaatattt      5040
     gacggctaca tctcatatat ccagtcggtt gccgccggca ggatcgacgc gccggtgctg      5100
     aacgaggacg accggcggct catagaagca tacaaccaca cggaatgggc ctgcgcgccc      5160
     gcctctccgg cggagctgtt tgaaaaacag gccgccgcgc gccccgaggc caccgccgtg      5220
     atctgcgagg gtgaacggat cacctacggg gacctggacg cccggagcaa ccgcctcgcc      5280
     aactacctga aaagtcacgg ggtcagccga ggcaacacgg tcggcatcct ttcggcaagg      5340
     caaatcgaga ccatcgtgaa tattctggcc gttctgaaat gccgggcggc ctacgttccg      5400
     attgacccgg gctatccgaa atcgcggtgc gactacattc tggaaaacag ttgtgccgac      5460
     cttttgatcg agaccgattt ttataaagag cacgacgtcg ggcaatatcc agccgaccgt      5520
     ttgccggagg cctgcgtccc agacgacgtt gcctacctca tctacacttc cggaagcacg      5580
     ggcaagccca agggcgtcat catttccaac aagtcggcct gcaacacggt cttggatatg      5640
     aaccgtaggt tccacgttac ggagcgggac atttttctcg gcatttcctc cctgtgcttt      5700
     gatctgtccg tctatgatgt attcggcgcg ctgtcgtgcg gcggggcact ggtgatggtg      5760
     ccggatcagc atgacatcgg acatctaatt gagacggtcg cgcagcagcg cgttaccatc      5820
     tggaattcgg tgccggcgat catgaacctg gctgtggaat tctgcgaaaa cgatccggac      5880
     gcgcggctga gcagcctgcg tctcgtcctg ctgagcggtg actggattcc gctgaagctg      5940
     ccggacagaa tccggcggca cgcccccgac gcgcagacga tcagcctggg cggagcgacg      6000
     gagggctcca tctggtccat ctactatccc atcgacgcgg ttgacgccgg ctggcgcagt      6060
     atcccatacg gcatgcccct cgccaatcag acgatttata tcgtcagcgg cgacggccgg      6120
     ctctgcccgg ttgctacgcc cggcgaaatc tgcatcgggg gcatcggcgt cgcaaacggc      6180
     tacgcgaaca acgaggccca gaccacagct tcctttattg cgcatcccca gctcgggagg      6240
     ctttacaaaa cgggcgattt tggaatactt acgtcggcgg gctatgtgga gttccttggc      6300
     cggcgggatg cacaggtcaa aatcaacggg taccgcgtcg agttgtccga ggtggaaaag      6360
     tgcatcgagg ggctggccgg cgtggaggcc gccaaagccg tggtactaca gggcaagggc      6420
     ggcagccatg tgatcggcgc gtttgtcaag gcgggccggg acgtgaccgc gcaggccgtg      6480
     cagcagcacg ccgccgcgca tttgccccgg tatatggtgc cgaccaccat ctccatcctg      6540
     gaggcgttcc cgctcacatt caacggcaag gtggatgtga agaagctctc cgcaaccgtg      6600
     gaaccggaac agcaaaccgt gcgggaaacc ggcgcttcca accagacgga ggaacgcctg      6660
     atccgcattt tcaaggaaac gctgcatctg gaggccgttg gtatccacac cagtttcttc      6720
     gacatgggcg tcaattccat tcagatcatt cagatcgcca ataaaattca tacggttttc      6780
     aacaagaaga ttgcctttaa ggacttcatc gacaaggaaa acatcagcga gctggcatcg      6840
     ctgctgcagg ataccgagca ggccgccgag gacgaggtaa cctaccggag cgtcgcaccc      6900
     gatcttgcca acctcaacga accgttcccg ctcacgcagg tgcagacggc ctacctgatg      6960
     ggccgcgaaa aaatattcga actgggcggc gtctccacgc acgggtatgc cgaaatggaa      7020
     aacgcacttg agccggaccg cctgaacgcc gcgctggaaa agctaatcgc caggcatccg      7080
     atgatgcgca tggtcatcct cgaaaacggc atgcagcaga ttctgaaata cgtgccaaaa      7140
     tacaggattg aagtcgtgga cctgcgcggg cttccggatg aagaaaagca gcagcgactg      7200
     atggatgaac gcgcacggat gtcgcactac attttcgatc ctggaaaatg gccgctgttt      7260
     gacctgcgca tctaccggct ggaaaatgcg aaaaacgcca tgtttgtggg gtacgacctg      7320
     ctgatggcgg acggcatgag tatccaggta atcagcaggg agctgatggc gtattatgag      7380
     cacccggaca ccgacctgca cccgattttc ttctcattcc gcgattatgt gctggcgctc      7440
     gaagatttta aacaaaattc gaaaacctat cagagcgacc gggcgtattg gctggaaaag      7500
     ctggaggatt tcccattttc accggctctt ccgctgaaaa tgccgccctc ggaggtggag      7560
     cagccgcatt tcaggcgact gagcaaggtg ttcggccagc gggactggtc gcgcatcaag      7620
     gaatttgccg cgagccagag cgtaacgccg tcttccctga tctgctccat ttacgcaaag      7680
     gttctggcgt tttggagcaa ctccaaccga tttgccttga acctgaccgt attcaatcga      7740
     tatccgttcc atgaggatgt caacgccgtc atcggggact ttacttccgt tttgctgctc      7800
     gatatcagtc tgaatcccgg ccacacactg gtggaaaccg cgcagcagac gcaaaagacg      7860
     atcatgagcg cgctgcagca ccgacactat gagggtgtcg acttcattcg cgacattgcc      7920
     aagcgctaca acctggagag aaaggctatc atgccggtcg tgttcaccag catgattttc      7980
     ggcgaaatgg accatcccga gccgtaccgc agcaaactgg gcaaaatcga aatgagcgtc      8040
     agccagacct cgcaggtcta cctcgacaac caggtctcag attccggcaa ccagctgacg      8100
     atcacctggg actatgtgga agaactgttt gacccggatg tcgtggcaaa aatgtttgac      8160
     caatacaccg gcatgcttac gcagattttg gaaggccccg tcaccggcag catcggcgtc      8220
     gatcaggatg cattccggca gattctggac tacaaccaga cccaaaagcc catgacggaa      8280
     accaccctgg cggaactgat ggaacggcag gccgctctgc atgcggaaca aatcgccgtg      8340
     atgtgcgaag ggatctctgt ctcctacggc gaactgtccc gcaagagcaa ccgtattgcc      8400
     cggtatttga aaagcaaagg aattgcgcgc ggcgcctttg tcggcgtgct gacggcgcga      8460
     cggattgaaa gcgtcgccaa cattttgggc gttttgaaag caggggccgc ctatgtgccg      8520
     atcaacccgg attatccgca gaaaagacgt gaatatatgt atgacaactg cgggtgctcg      8580
     ctgctcctcg tcccggatac atacgaagag gagcagttgg aacgcctgga cgactccgca      8640
     atgttggacg gcaggccgga ggatgtcgct tatgtcattc atacgtccgg cagtacggga      8700
     aatccaaagg gcgtcgtaat cagcaaccag gcggcctgca acacgatttt ggacatcaac      8760
     gagaaatttg gagtcagtgg gcaggatcgt atattgggga tatcttccat gtgctttgac      8820
     ctgtcggtct atgatctgtt cggggcgttt gctgcgggcg cgacgctggt catcgttccg      8880
     gaccagcggg atatcgcaca tctgctggaa ctggtggagc gcgaaaaaat caccgtttgg      8940
     aactctgtgc cggcgatcat ggagctggcc gtcgggcagt tgaaccgcga aaccggcgcg      9000
     gaaccgcccc gtatggtaca ggcggcggcg cggccgtccg ccatggcgcc ccgggagaac      9060
     gagctgtact actggtcccc cgccgtccac tggaccgaac gggatgggca tatcatggcg      9120
     ggcgattacg tctgcccgga cgaaatggcc aaattgatgc cggcgtttta tttcagggcc      9180
     caagcgggcg caacgcttgc ggagctggct cagctctacg gcgcgcagtc ggactccttc      9240
     ccgcattttc tcaaggaact gaccgagcac cgggtgctgg tcaacagcat ccttcccccg      9300
     gacgaaatct ttgcgcagca aaacaaaatg tttgtcaatc catatgcgga agatattatt      9360
     tacaattatg aagcaaacct tcgcttcaag gaagagcagc tcaatcggac ggtggtgcgc      9420
     ggcggaaagc cggtcacttt cccgaatcgc taccaatacc cgccctccat tgcgaacagg      9480
     agaagcgtgc gcgattatga tacagagcgc ccggtgccat ttgatacgct gtgcgcgttt      9540
     ctctccgtga tgcaccagaa tgtggaagac cgacactatc aatattacta tgcgagcgcg      9600
     ggcgggcttt accccatcga catttatctc catgtgaagc cgggacgggt tgaaaatctg      9660
     gaacagggca tttattatta caaccctgtc gccaattcgc tgcaactggt ggagccaaat      9720
     cccaccctga cggaagcggc acattactac acgaataaga agattttcaa aagctccgcg      9780
     ttttcggttt tcttccttta caatgcgggc gccaacatgc cgaaatacgc agggaaaggt      9840
     tacttctatg cgattctgga cgccggtatt ctggcggcga cactgacgca cacggcggag      9900
     ctgatccatc ttgggacctg ttctatcggc gatatgatgt tccgcaaagt agaagcggac      9960
     ttccatctca actgcaacca ggtctgggtt cacaccatgg aggtcggttt gaaaaaggcg     10020
     gaaaacggca cggcgcctga aatgatcgaa acgatcacgg tgaaccggct ggagtccggg     10080
     ccggctgaac aaacggttga acaaaaaacg gaagagacgc cctcttttcg agcgggacag     10140
     tgggacgcag ccagcctgcg gctagtgctg ttgagcggcg attggatccc gctccacctg     10200
     gccgggcaga tcaaaacagc atgcccgaac gcgcagatta tcagcctggg cggggcaacc     10260
     gaggcgtcta tatggtctat ctattacccg atccgcgcgg taaagacgga atggagcagc     10320
     attccgtacg gcatgcccct cgccaaccag accatttaca tcatggggct ggatgaggaa     10380
     ctctgcccta tcggcacccc gggggagatc atgatcggcg gagcgggtgt ggccgaagcg     10440
     tacatcaacg acgaacagaa aacgcaagcc gccttcgtcg tccatccaaa attgggccgg     10500
     ctgtacaaaa ccggggacta cgggatcttc cgcccggaag ggtatgtgga atttcttgga     10560
     agaaaggatt cccaaatcga gatcggcggc catcgcatcg agctgggcga aatcaccgcc     10620
     aatctggagc aaaaccccaa cactgcaaag tgcgtttccg tgccgtatac agacacaaac     10680
     gggattgagc aaatatgctc gtatgtcgtg ctgaaaaacg ctgtcctgat cagcgaactg     10740
     cgcgcgtatc tgaaagaacg gctgccggat tacatggtgc ccgcccgcat tctggaggtc     10800
     aacgagattc ccctgaccga taacggaaag ctgaacacga aagcactgcc cgaccccagg     10860
     ctattcggac gggagaccgc ctcctacgag ggcccatcca ccgagatcga gcaaaagctg     10920
     gaagcaatcg tcgcgcagta tgtcggcacg gggaaagtca gcgtcaccga cgatattttc     10980
     gaagcagtcg gaaactccgt catcctgatc cagatgcatc aggaaatcga ccgcatgtac     11040
     cccggaatcg tcaaagtcgt cgatctattt aacaggccca ccattcgcca gatcgcggcc     11100
     tttattcagg aaacgtcagc acagcggcac aaacgacggt atccccccat ctgcctgccg     11160
     gagaactggt tcgttccgaa aaacgttgcg aagccctgtc aggccgacat cgccatccgg     11220
     gagtcgcaat acgccgcgct ggcccgcgcc gcccggcatt tcagcacacc catcggcaca     11280
     ttggttttca tctcgtttgc ctacgcgctg gcgggaatga ctgcccagga aacacttcac     11340
     ctgcccggcg tcattaaccg aaccaaccaa atggaactgt ttgaaatcga tttttccggc     11400
     aaaagcagct tctccgagct gctggaagac cagcaggccg ttaaaatcgt gcagacaggc     11460
     ccgttcacaa atcgcgcgga cgattgggtg gacaagggca agtacgcaat tgtcccgctc     11520
     gtctacaaca aatccctgct caacagcaac gtcgcgttgt ccgagcaata tgacctgtgc     11580
     ctggcgtttg atgagaacag cggaacgcgc gagctctccg cggagatccg atcgtccagg     11640
     ctggcgcccg aaaaactgcg ttcgcttgtc ggcgtgttgg gcaaaacgct cgagcttttg     11700
     acgaaagaaa ccgcactctg a                                               11721
//

If you have problems or comments...

PBIL Back to PBIL home page