(data stored in ACNUC9435 zone)

EMBL: CP002400.PE278

CP002400.PE278       Location/Qualifiers
FT   CDS_pept        complement(312035..313546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0283"
FT                   /product="ABC-type uncharacterized transport system"
FT                   /note="PFAM: ABC-type uncharacterised transport system;
FT                   KEGG: csc:Csac_0364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25869"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7D4"
FT                   /inference="protein motif:PFAM:PF09822"
FT                   /protein_id="ADU25869.1"
FT                   /translation="MANQTQKNDPHKNKPRRKLPDFMRQRSFRYGSTATAFTVIFIVAV
FT                   ILVNVLVTSLSSRFPLSVDMTANHKNQLSTQSVSFVKKINQDINIDILADESTYSNAQN
FT                   YNSCLLIMQQYAQHNSHIHISFVNLDKNPTYASKYPKETLSQADIIVSCGSIYKHIVSS
FT                   DLLTTSTDSTTGSSTVTGNNTEQVIDSAIAYVTAKTLPTVLVTSGHNETDSSALTSLLQ
FT                   KNNYQIETKNLATDGLDQNAKMILINAPTADFSADDIAKLDTFLNNGGKYGKTVFLIFD
FT                   PQQASAPNLESFAKKWGISVGTGVVYDTTNRYQDSPFSVLEGQTNSTYVGTLQSGLHAY
FT                   LSVCRPLTLSSSDSSITTASIVATESTSKLWNPGTINSSTAASFQASNSDKTGPFDVFG
FT                   VATKTATSGSESVKSNVLVLGSTNFFNSQVLAQPSLTNSTILLNTVGNVIGFNPGITVE
FT                   AKDLTTQSLTITAGQAIGIIVVFAFLIPLAVLIAGLVNWIRRRHQ"
     atggccaatc aaacgcaaaa aaacgatccg cataaaaaca agccccggcg aaaactgcct        60
     gatttcatgc gccaacgcag ctttcgctac ggcagcaccg ccacggcttt caccgttatt       120
     ttcatcgtgg ccgtcattct cgtcaatgtg ctggtcactt cgctgagcag ccggtttccg       180
     ctcagcgtgg acatgaccgc caaccataaa aatcagctct ccacgcagtc ggtcagcttt       240
     gtcaaaaaga tcaatcagga tatcaacatc gacattctgg cggacgaatc cacgtattcc       300
     aacgcgcaga actacaattc ctgcctgctt atcatgcagc aatacgcgca gcacaacagc       360
     cacatccata tcagcttcgt caaccttgac aaaaatccga cctatgcctc caaataccca       420
     aaggaaacgc tgagccaagc cgacatcatc gtctcctgcg gcagcattta taagcacatc       480
     gtctcatccg acctgctcac cacctcgacc gacagcacca ccggctcctc caccgtgaca       540
     ggcaacaaca ccgagcaggt gatcgattcg gccatcgcgt atgtcaccgc caaaacgctg       600
     ccgaccgtcc tggtcacctc cgggcacaat gaaaccgaca gctccgcgct gacctctctg       660
     ctccagaaaa acaactacca gatcgagacc aagaacctcg cgaccgacgg cctcgaccag       720
     aacgcgaaga tgatcctcat caacgcgccc accgccgatt tctccgccga cgacatcgcc       780
     aagctcgaca ccttcctcaa caacggcggc aaatacggta agaccgtttt cctcatcttc       840
     gacccgcagc aggcttccgc ccccaatctg gaaagctttg cgaaaaaatg gggcatcagc       900
     gtgggcaccg gcgtcgtcta cgacaccacc aaccgctatc aggacagccc cttcagcgtt       960
     ctggaagggc agaccaacag cacctacgtg ggcacgctgc aaagcggcct gcacgcctac      1020
     ctgagcgtgt gccgcccact cacgctgtcc tccagcgaca gcagcatcac cacggcatcc      1080
     atcgtggcca ccgagagcac gtccaagctg tggaatcccg gcaccatcaa cagctctacg      1140
     gcggccagct tccaggcctc gaacagcgat aaaaccggcc cgttcgatgt gttcggcgtc      1200
     gccaccaaaa cggcgacttc tggttccgaa tccgtaaaat caaacgtact ggtgctcggt      1260
     tccaccaatt tctttaactc gcaggtgctt gcccagccca gcctgaccaa ctccaccatc      1320
     ctgctcaaca cggtcggcaa cgtcatcggc ttcaatcctg gcatcaccgt cgaagccaaa      1380
     gacctcacca cccagagcct caccatcacg gccgggcagg cgatcggcat catcgtcgtc      1440
     tttgccttcc tcatccccct tgccgtgctg attgccgggc tggtcaactg gatcaggagg      1500
     aggcaccaat ga                                                          1512
//

If you have problems or comments...

PBIL Back to PBIL home page