(data stored in ACNUC9435 zone)

EMBL: CP002400.PE289

CP002400.PE289       Location/Qualifiers
FT   CDS_pept        complement(325485..326021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0294"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="KEGG: cth:Cthe_2655 AbrB family transcriptional
FT                   regulator; TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25880"
FT                   /db_xref="GOA:E6U7E5"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR039472"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E5"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ADU25880.1"
FT                   /translation="MKATGIVRRIDDLGRVVIPKEIRRTMRIREGDPLEIYTDNDGEVI
FT                   FKKYSPIGELSNFAAQFAEVLGKSSGYPVLISDRDRIISSFGIPRKEVLERRVSEELEA
FT                   LLEQRRPYICEDGHHLTAVDGLEKSVAVAVPILAAGDMAGAVILLDTEENAKPGDVELK
FT                   LAQTAANFLAKQMEE"
     ttgaaagcaa ccggcatcgt ccgacgcata gacgatctgg gtcgcgttgt cattccgaaa        60
     gagatccgcc gcaccatgcg gatccgcgaa ggcgacccac ttgaaatata taccgataac       120
     gatggcgagg taatcttcaa aaaatattcc cctatcgggg aactgtccaa ttttgccgca       180
     cagtttgcgg aagtgctggg caagtcctcc ggatacccgg tcctcatctc ggaccgcgac       240
     cgcatcatct cgtcgttcgg catcccgcgc aaagaagtgc tggagcgccg cgtgagcgag       300
     gaactggagg cattgctgga gcagcgccgc ccgtatatct gtgaagacgg ccaccatctc       360
     accgcggtgg acggtctgga aaaaagcgtg gcggtggccg tgcccatcct ggccgccggc       420
     gacatggcgg gcgccgtcat cctgctggac acggaagaaa acgcaaaacc cggcgacgtg       480
     gagctcaagc tggcgcaaac ggcggccaat tttctggcca aacaaatgga agaataa          537
//

If you have problems or comments...

PBIL Back to PBIL home page