(data stored in ACNUC9435 zone)

EMBL: CP002400.PE290

CP002400.PE290       Location/Qualifiers
FT   CDS_pept        326279..326464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0295"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25881"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ADU25881.1"
FT                   /translation="MYYNCLNVWCFARRAAGGFGSAAAQNDDSPFFVRMADDDRVQMET
FT                   ENREGQTVWAKKTESN"
     atgtattata attgtttaaa cgtatggtgt tttgcacggc gtgcggcggg cggtttcggc        60
     agcgccgccg cgcaaaatga cgattcgccg tttttcgtcc gcatggcgga cgatgaccgc       120
     gtgcagatgg aaacggaaaa ccgggaaggg cagacggtat gggcgaaaaa aacagagtca       180
     aactga                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page