(data stored in ACNUC9435 zone)

EMBL: CP002400.PE293

CP002400.PE293       Location/Qualifiers
FT   CDS_pept        329020..329478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0298"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number="3.6.1.23"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; KEGG: aac:Aaci_1445 deoxyuridine
FT                   5'-triphosphate nucleotidohydrolase Dut; PFAM: deoxyUTP
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25884"
FT                   /db_xref="GOA:E6U7E9"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7E9"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ADU25884.1"
FT                   /translation="MSKIILKVKTVPHDGVEVQYPRRATGGSAGMDLHAALRGPVKIAP
FT                   RGLVSIPTGIAIQMPGDGYAAFIYARSGLATRHGIALSNGVGVIDSDYTGELIVGLCNL
FT                   SDRAYVVMPGERIAQLVISPVCAPELFEVEELEETARAGSGFGSTGRY"
     atgtccaaaa tcattctgaa agtgaaaacg gtgccacacg acggcgtgga ggtgcaatat        60
     ccgcgccggg ccacgggcgg ctcggcgggg atggatctgc atgccgccct gcgcgggccg       120
     gtgaagatcg cgcccagagg gctggtgtcc atcccgacgg ggattgccat ccagatgccg       180
     ggcgacggct atgccgcatt catctatgcg cgcagcgggc tggcgacacg gcacggcatc       240
     gcgctttcca acggcgtggg tgtgatcgac agcgattata ccggcgaatt gatcgtggga       300
     ttgtgcaatc tttcggatag agcctatgtc gttatgccgg gcgagcgcat cgcgcagttg       360
     gtcatttccc ctgtctgcgc gcccgaactg tttgaagtgg aagaactgga ggagaccgcg       420
     cgcgccggga gcgggtttgg ctccacgggc cggtattga                              459
//

If you have problems or comments...

PBIL Back to PBIL home page