(data stored in ACNUC9435 zone)

EMBL: CP002400.PE30

CP002400.PE30        Location/Qualifiers
FT   CDS_pept        complement(31969..32649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0030"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   har:HEAR0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25621"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F4"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ADU25621.1"
FT                   /translation="MAQIPYTLVRSTRKTVAIQIRQDGEVIVRAPQRMPAAAIESFLCE
FT                   KQRWVESARKRMRERAAQRACAAAEPGGTLWYLGRPYPVAAREDADLPDPPVWDGNAFY
FT                   LPSRDPARAAAAFFTARAEERLLARAAFFAKQAGLSYPSLTVGSARSRWGSCGKDNRLR
FT                   FSWRLLCAPPPAVDYVVAHELAHIRHHDHSPAFWREVARVWPEWETGADALRLFERQVD
FT                   LRAL"
     atggcgcaga taccctacac actggtgcgc agcacacgca aaaccgttgc catccagatc        60
     aggcaggatg gggaggtcat cgtccgcgcc ccgcagcgga tgcctgccgc cgccatcgaa       120
     tcgttcctgt gtgaaaagca gcgctgggtc gagagcgcac gcaaacgcat gcgcgaacgc       180
     gccgcgcagc gcgcctgcgc ggcggcggag ccgggcggca ccctgtggta tctgggcagg       240
     ccatatcccg tcgctgcgcg ggaagacgcc gacctcccgg acccgccggt ctgggacggc       300
     aatgcgtttt atctgccatc ccgggacccc gcgcgggccg cggccgcctt tttcaccgcg       360
     cgggctgaag aacggctgct cgcccgcgcg gccttttttg ctaaacaggc gggtctgtcc       420
     tacccaagcc tgactgtggg cagcgcgcgt tcacgctggg gctcatgcgg caaagacaac       480
     cgcctgcgct tctcctggcg gctgctctgc gcgccgccgc ccgccgtgga ctatgtggtg       540
     gcgcatgagc tggcacacat ccgtcatcac gatcattccc cggctttctg gcgcgaggtg       600
     gcgcgggtct ggccggagtg ggaaacaggc gcggacgccc tgcgcctgtt cgaacggcag       660
     gtggacctgc gcgcgcttta a                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page