(data stored in ACNUC9435 zone)

EMBL: CP002400.PE313

CP002400.PE313       Location/Qualifiers
FT   CDS_pept        347383..348387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0318"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: gem:GM21_1061 radical SAM domain protein;
FT                   PFAM: Radical SAM domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25904"
FT                   /db_xref="GOA:E6U7X2"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR032432"
FT                   /db_xref="InterPro:IPR039661"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7X2"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25904.1"
FT                   /translation="MGKAANVAFFVPHLGCAHACSFCDQRSIAGQAAPPSPADVAGTLA
FT                   RVREQMGSRSRDAEVAFFGGSFTAIPRRQMLALLEAVAPFLGADGFSGIRVSTRPDAVD
FT                   DDVLALLRAHGVTSIELGAQSMDDAVLCRNGRGHTARQVRDAALRVGRAGFSLGLQMMT
FT                   GLPGDGPAGARRTARELAALHPDTVRIYPALVLRGTRMAAWWADGTYEPQPLDDAVLLC
FT                   AALFDYFTRRGIRVLRMGLHAEPSLEQNLLAGPWHPAFGELCESRVYYTRARRALARAP
FT                   GADCLLAPRGETGKVAGQHRRNLLALEARVDRRLHIREDPGLPPLAVRAVKCL"
     gtgggcaaag cagcgaacgt ggcttttttt gtgccccatc tgggctgcgc gcacgcctgc        60
     tcgttctgtg accagcgcag catcgccggg caggccgccc cgccgtctcc cgcagacgtg       120
     gcgggcacgc ttgcccgcgt ccgggagcaa atgggcagcc gctcccgcga tgcggaggtc       180
     gcctttttcg gcggcagttt caccgccatt ccgcgccggc agatgctggc acttctggaa       240
     gccgtcgcac cgtttctcgg tgcggacggc ttttcgggta tccgtgtctc cacccggccg       300
     gatgctgtgg acgatgatgt gctggcgctg ctgcgggcac acggcgtgac atccatcgag       360
     cttggcgcgc agagcatgga cgacgcggtg ctgtgccgga acggccgcgg ccacaccgcc       420
     cggcaggtgc gggacgccgc cttgcgcgtc gggcgtgcgg ggttttcgct tggtctgcaa       480
     atgatgaccg gcctacccgg ggacggtccg gcaggcgcgc gccgcaccgc gcgcgaactg       540
     gccgccctgc atccggatac cgtgcgcatt tatccggctc tggtgctccg gggcacgcgc       600
     atggccgcct ggtgggcaga cggcacgtat gaaccccagc cgctggatga cgccgtgctg       660
     ctctgtgccg cgctgttcga ttattttacc cgcagaggca tccgtgtgct gcggatgggc       720
     ctgcatgccg agccttcgct ggaacagaac ctcctggccg gaccgtggca tcccgcgttt       780
     ggcgagcttt gcgaaagccg cgtctactat acccgcgcgc gccgggcgct ggcccgtgcc       840
     cccggtgccg actgcctgct cgccccgcgt ggcgaaaccg gcaaagtggc aggccagcac       900
     cggcgcaacc tcctcgcgct tgaggcgcgg gtggaccgcc gtttacatat ccgtgaagac       960
     cccggtctgc cgccccttgc ggtgcgcgcg gtcaaatgcc tgtaa                      1005
//

If you have problems or comments...

PBIL Back to PBIL home page