(data stored in ACNUC9435 zone)

EMBL: CP002400.PE331

CP002400.PE331       Location/Qualifiers
FT   CDS_pept        complement(368557..369957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0336"
FT                   /product="asparaginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.22"
FT                   /note="TIGRFAM: asparaginyl-tRNA synthetase; KEGG:
FT                   cth:Cthe_0070 asparaginyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25922"
FT                   /db_xref="GOA:E6U7Z0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z0"
FT                   /inference="protein motif:TFAM:TIGR00457"
FT                   /protein_id="ADU25922.1"
FT                   /translation="MHMQRTEIRDLFARADSFTAADITVAGWVRTLRHSKSIGFLELND
FT                   GSCFGHLQAVCDEQALTNFGEVMKLGVGAAVVVRGRLALTPQARQPFELHAASVEIEGT
FT                   CPPDYPLQKKRHTLEFLRTMPHLRPRANTLGAAFRIRSTAALAIHRFFHTHGFQYIHTP
FT                   IITASDAEGAGEMFRLTVLDIADPPRTPDGAVDFSKDFFGRPVSLTVSGQLEGESMALA
FT                   FGKIYTFGPTFRAENSNTTRHAAEFWMVEPEIAFADLDDDRALARDMMQAVLKTVLDEC
FT                   PDELAFLNQYVDKGLLARLEHVATSDFACVTYTEAVKLLEKENARFSYPVSWGCDLQTE
FT                   HERYLTEEIFKAPVFVVDYPKEIKAFYMRQNGDGKTVAAMDLLVPGIGEIIGGSQREER
FT                   ETVLLTRMEELGMPIEAYRWYLDLRRFGGARHAGFGLGFERLVMYLTGIGNIRDVLPFP
FT                   RTAGTAGF"
     atgcacatgc agcgcacgga gatacgggac ttgttcgccc gcgcagacag ctttacggcg        60
     gcagacatca cggtggccgg gtgggtacgc actttacggc actccaaatc catcggtttt       120
     ctggagctga acgacggcag ctgtttcgga catttgcagg cggtatgcga cgagcaggcg       180
     ctcaccaatt tcggcgaggt gatgaaactg ggcgtaggcg cggcggtggt cgtgcgcggg       240
     cggctcgcgc tcacgccgca ggcgcgccag ccgttcgaac tgcacgccgc gtcggtggag       300
     atcgagggca catgcccgcc cgactacccg ctccagaaaa aacgccacac gctggaattc       360
     ctgcgcacca tgccgcacct gcggccgcgc gccaacacgc tgggtgcggc gttccgcatc       420
     cgatcgacgg cggcgctggc tatccaccgc ttcttccaca cgcacggctt ccaatatatc       480
     cacacgccca tcatcactgc cagcgatgcc gagggcgcgg gcgaaatgtt ccgcctgacg       540
     gtgctggaca tcgccgaccc gccccgcacg ccggacggcg cagtggattt ttcaaaagat       600
     ttcttcgggc ggccggtgag cctgacggtc tccggccagt tggaaggcga gagcatggcg       660
     ctggcgttcg gcaagatcta tacgttcggg cccacgttcc gcgccgaaaa ttccaacacc       720
     acccgccacg cggcggaatt ctggatggtg gagccggaaa tcgccttcgc cgacctggac       780
     gacgaccgcg cgctcgcacg ggacatgatg caggcggtac tgaaaaccgt gctggacgaa       840
     tgcccggacg aactggcgtt tttaaaccaa tatgtggaca agggcctgct cgcgcgcctg       900
     gagcatgtgg ccacttcgga ctttgcctgc gtgacctaca ccgaggcggt gaagctgctt       960
     gaaaaggaaa acgcgcgctt cagctatccg gtgtcctggg gttgcgatct acagaccgag      1020
     catgaacggt atttgacgga agaaatcttt aaggcgccgg ttttcgtggt ggattatccc      1080
     aaagagatca aggcgtttta catgcggcaa aacggcgatg gcaaaaccgt ggcggccatg      1140
     gacctgctgg tgccgggcat cggggagatc atcggcggct cgcagcgcga ggagcgcgaa      1200
     accgtgctgc ttacgcgtat ggaggaactg ggcatgccca tcgaggccta ccgctggtat      1260
     cttgacctgc ggcggtttgg cggcgcacgg catgccgggt tcgggctggg gttcgagcgg      1320
     ctggtgatgt acctcaccgg catcggcaat atccgcgatg tgcttccctt cccgcgcacc      1380
     gccggcacag ccggctttta a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page