(data stored in ACNUC9435 zone)

EMBL: CP002400.PE334

CP002400.PE334       Location/Qualifiers
FT   CDS_pept        374578..375867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0339"
FT                   /product="Uncharacterized conserved protein UCP033563"
FT                   /note="PFAM: Uncharacterised conserved protein UCP033563;
FT                   KEGG: cth:Cthe_3196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25925"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z3"
FT                   /inference="protein motif:PFAM:PF06245"
FT                   /protein_id="ADU25925.1"
FT                   /translation="MEKKLQWGAFGPADILLPRGCSMQKWSVVACDQYTSEPEYWDEVE
FT                   KFVGDAPSTLRLMFPEVYLDKEDPAARIQEIHAAMRAYLDAGRFSRLKDSFVYLERRLP
FT                   SGAVRRGLVGAVDLEQYDYSPGSASPIRPTEGTVVARIKPRMQIREGAPIELSHVMLLI
FT                   DDPDGTVIEPIARHKGALAPLYNFDLMQNGGHLSGWWLPADQAGAVRQALAALASPEAF
FT                   AKKYGLPDRPVLAYASGDGNHSLATARACYEHLKEKIGDAAKSHPARYAMVELVNIHDE
FT                   SLIFEPIHRVLTGVDAAKLRHDFITAMAADGGSLDSGDPARRVRFLHEGGDVTAYLGGD
FT                   VLPVGMVQDFLDGWMQENGGKIDYVHGDEVTARLGTQPGAASFLLPALGKSALFASVAR
FT                   DGALPRKTFSMGDANEKRFYLECRRITEDA"
     atggaaaaaa agctgcaatg gggggcgttc ggccccgcgg atattttgct gccgcgtggc        60
     tgcagcatgc agaaatggag cgtggtggcc tgcgaccagt acaccagcga gccggaatat       120
     tgggatgaag tggagaaatt tgtgggtgac gcgccttcca cgctgcggct gatgttcccg       180
     gaggtctacc tcgacaagga ggaccccgcc gcgcgcatcc aagagattca cgccgccatg       240
     cgcgcttatc tggacgcggg gcgtttttcc aggctgaaag acagctttgt ctatctggaa       300
     cgcaggctgc cttccggcgc ggtgcggcgc ggcctggtgg gcgcggtcga tctggaacag       360
     tatgattaca gcccgggttc cgcttcgccc atccgtccca ccgaaggcac ggtggtggcg       420
     cgcatcaagc cccggatgca gatccgcgag ggcgcgccca ttgaactgtc gcatgtgatg       480
     ctgctgatcg acgatccgga cggcacggtc atcgagccca tcgcccggca caagggcgcg       540
     ctcgcgccgc tttacaattt cgatctgatg cagaacggcg ggcatctgag cggctggtgg       600
     ctgccggccg accaggcggg cgcggtgcgg caggcgctgg cggcgttggc ttcccccgag       660
     gcctttgcca aaaagtacgg cctgccggac aggccggtgc ttgcttatgc gtcgggcgac       720
     ggcaaccatt cgctggccac ggcccgcgcg tgctacgagc atctcaagga aaagatcggc       780
     gacgcggcga agagccaccc cgcgcggtac gccatggtgg aactcgtcaa catccacgac       840
     gaatcgctca tcttcgaacc catccaccgg gtgctgaccg gggtggacgc cgccaagctg       900
     cgccatgatt tcatcaccgc catggcggcg gacggcggct cgctggacag cggcgacccg       960
     gcgcgccggg tgcgctttct gcatgagggc ggcgatgtga cggcctatct gggcggcgac      1020
     gttctgccgg tgggcatggt gcaggatttc ctggatggct ggatgcagga gaacggcgga      1080
     aagatcgact atgtccatgg cgacgaggtg accgcccggc tgggcacaca gccgggcgcg      1140
     gcgtcgtttt tgctgcccgc cctcggcaaa tcggcgctgt tcgcgtccgt cgcgcgggac      1200
     ggcgcgctgc cccgcaagac gttctcgatg ggcgatgcca atgaaaagcg gttctatctg      1260
     gaatgccgcc gcatcacgga ggacgcgtga                                       1290
//

If you have problems or comments...

PBIL Back to PBIL home page