(data stored in ACNUC9435 zone)

EMBL: CP002400.PE336

CP002400.PE336       Location/Qualifiers
FT   CDS_pept        376330..376965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0341"
FT                   /product="Hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="KEGG: adg:Adeg_0381 hydroxyacylglutathione
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25927"
FT                   /db_xref="GOA:E6U7Z5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E6U7Z5"
FT                   /inference="protein motif:PRIAM:3.1.2.6"
FT                   /protein_id="ADU25927.1"
FT                   /translation="MHIQYLRVGRLETNCYIVCNDETKRCAVIDPGADAARIIDAVRRS
FT                   GCAPDMILLTHGHFDHIGAVRELLAEFGCKLAAPKAELDFLNNPHRNLHSSMSGEDFVP
FT                   FAPDILFEDGDTVEAAGLSFKALHTPGHTPGSSCLLCDDVLFTGDTLFAGSAGRTDFPG
FT                   GDPAAMRASLRKLAMLAGNYQVLPGHGPFSTLEKERVENPYLEGAADA"
     atgcatatcc agtatctgcg ggtggggcgg ttggagacca actgctacat cgtttgcaac        60
     gacgagacca aacggtgcgc ggtcatcgac cccggggcgg acgcggctcg catcatcgac       120
     gccgtgcgcc ggagcggctg cgcgcccgac atgattttgc tcacccacgg gcatttcgat       180
     cacatcggcg ccgtgcggga gctgctggca gagttcggct gcaagctggc ggcgccgaaa       240
     gcggagctgg acttcctgaa caatccgcac cgcaacctgc attcctccat gagtggggag       300
     gatttcgtgc cgttcgcgcc ggacatcctg tttgaggacg gcgacacggt ggaggctgcc       360
     ggattgtctt ttaaagcgct gcacacgccg gggcacacgc ccggctcctc ctgcctgctc       420
     tgcgacgacg tgctctttac cggggacacg ctgtttgccg gcagcgcggg ccgcaccgat       480
     tttccgggcg gcgaccccgc cgccatgcgc gcgtctttgc gcaagctggc tatgttggcg       540
     ggcaactatc aagtgctgcc ggggcacggg ccgttttcca cattggagaa agaacgtgtg       600
     gaaaacccct atctggaggg tgcggcggac gcatga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page