(data stored in ACNUC9435 zone)

EMBL: CP002400.PE342

CP002400.PE342       Location/Qualifiers
FT   CDS_pept        382233..382508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0347"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="KEGG: tpd:Teth39_0249 histone family protein
FT                   DNA-binding protein; PFAM: histone family protein
FT                   DNA-binding protein; SMART: histone family protein
FT                   DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25933"
FT                   /db_xref="GOA:E6U801"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E6U801"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ADU25933.1"
FT                   /translation="MTKAELIAKVAEKSGLSKKDAEKATGALIDSIVESLVAEEKVQLV
FT                   GFGTFEVHHREARKGRNPRTKEEITIPASAYPVFKAGKPFKDAVSK"
     atgacaaaag ctgagttgat tgcgaaagtt gccgaaaaat ccgggctttc caaaaaagat        60
     gcggaaaaag cgaccggcgc cctgatcgat tccattgtgg agtcgctcgt ggccgaagaa       120
     aaagtgcagc tggtgggttt cggcacattt gaagtgcacc accgggaagc gcgcaagggc       180
     cgcaaccccc gcaccaaaga agagatcacc attccggcgt ccgcttatcc ggttttcaag       240
     gcgggcaaac cgtttaaaga cgctgtttcc aagtaa                                 276
//

If you have problems or comments...

PBIL Back to PBIL home page