(data stored in ACNUC9435 zone)

EMBL: CP002400.PE343

CP002400.PE343       Location/Qualifiers
FT   CDS_pept        382536..382781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0348"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="KEGG: clj:CLJU_c41660 putative S4 domain-containing
FT                   protein; PFAM: RNA-binding S4 domain protein; SMART:
FT                   RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25934"
FT                   /db_xref="GOA:E6U802"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025490"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6U802"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ADU25934.1"
FT                   /translation="MRLDKFLKVSRIIKRRTVANEACDAGRVLVGGKPVRASYEVKPGD
FT                   VLEITLGGKPFRAEVLEVAEHVTKEGASSLYRVLDA"
     atgcggctcg acaagttttt gaaagtttca cgtatcatca aacggcggac cgtggccaac        60
     gaggcctgtg atgcgggccg cgtgctggtg ggcggaaaac ccgtgcgcgc atcttatgaa       120
     gtcaaacccg gggatgtgct ggaaatcacg ttgggcggca aaccgttccg tgccgaagtg       180
     ctggaggttg ccgagcatgt gaccaaagag ggcgcgtctt ccctatacag ggttctggat       240
     gcataa                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page