(data stored in ACNUC9435 zone)

EMBL: CP002400.PE35

CP002400.PE35        Location/Qualifiers
FT   CDS_pept        complement(37451..38722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0035"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amt:Amet_4521 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25626"
FT                   /db_xref="InterPro:IPR025275"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5F9"
FT                   /inference="similar to AA sequence:KEGG:Amet_4521"
FT                   /protein_id="ADU25626.1"
FT                   /translation="MVRSIGVCKTRCIKVARKRYQFDPSGRRHKRGGSNPLMTALIVVA
FT                   VAALVFIGWNIYVPLQRVLKGDAGKTVESAASHVSSASHAASKPSSSSGSTSSAAATAM
FT                   RGIYLPGGTLTTATISQTLQAAKSAGVTTAIAELKSDDGVLHYASKISEVQNNGIVASG
FT                   ALDGAAIAQAITQSGMTPAARISCFKDPLAPTVMRDAAVKYAGNHSTNWLDESGNRWLN
FT                   PYSATTVQYLTDLAAEAASMGFKQIYLDNVQFPSGAQNHVWYGDNLPSKESALQSFVAA
FT                   VTQKVHTTGGTVTLVLPANAAVGSGQASLGQDQDPFGYGADTVSPLLTPVSLDGLTVGG
FT                   TALPNPISDFGAAVSAAAQGLKTLNASKYGDMVPFIQAGTVSGSGTVTADTVNAEVSAL
FT                   KAAGIDHFVFYATGGYNLTGVAAK"
     atggtccgca gcatcggcgt gtgcaaaacg aggtgcataa aagtggcaag aaaacgttat        60
     caattcgatc ccagcgggcg gcgacacaaa cggggcggga gcaacccgct catgactgct       120
     ctgatcgtgg tggcggtcgc cgcactggtc ttcatcggct ggaatatcta tgtgcccctg       180
     cagcgggtac tgaaaggcga tgcgggaaag accgtggaaa gtgcggcttc ccacgtatcc       240
     tccgcatccc acgccgcttc caagccgtcc tcctcctcgg gttcaacctc ttccgcagcg       300
     gccacagcca tgcgtggcat ttacctgccg ggcggcacgc tcaccaccgc aaccatcagc       360
     cagaccctgc aggccgccaa aagcgcaggg gtcaccacag ccattgccga gctcaaaagc       420
     gatgacggtg ttctgcacta cgcgtccaag atcagtgagg tgcagaacaa cggcatcgtt       480
     gcctcgggcg cgctggacgg cgccgccatc gcgcaggcca tcacccaaag cgggatgacc       540
     cccgccgcgc gtatcagctg tttcaaggac ccgctggccc ccaccgtgat gcgggatgcc       600
     gcggtgaaat acgccggcaa ccacagcacc aactggctgg atgaaagcgg gaaccgctgg       660
     ctcaatccct attccgccac cacagtgcaa tatcttaccg acctggcggc cgaggcagcc       720
     tccatgggct tcaagcagat ttacctggac aatgtgcagt tcccgtccgg cgcacagaac       780
     cacgtatggt acggcgacaa cctgccgtcc aaggaaagcg ctctccagag ctttgtagcg       840
     gcggtcacgc aaaaagtcca caccacgggc ggcaccgtca cactggtgct gccggcaaac       900
     gcggcggtcg gcagcgggca ggcgagtctg gggcaggatc aagatccgtt cggctacggc       960
     gcggatacgg tcagcccgct gctcacaccg gtttccctgg acgggctgac cgtgggcggc      1020
     accgctcttc caaatccgat cagcgatttc ggcgcggctg tttccgctgc cgcacagggc      1080
     ctgaaaacgt tgaatgcgtc caaatatggc gacatggtgc cgtttatcca ggcgggtacg      1140
     gtgagcggca gcggcaccgt tacggcggat acggtcaacg ccgaggtctc cgccctgaaa      1200
     gccgcaggta tcgaccattt tgtcttctat gccaccggcg ggtacaatct caccggcgtg      1260
     gcggcaaaat aa                                                          1272
//

If you have problems or comments...

PBIL Back to PBIL home page