(data stored in ACNUC9435 zone)

EMBL: CP002400.PE351

CP002400.PE351       Location/Qualifiers
FT   CDS_pept        388469..389770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0357"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ssa:SSA_0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25942"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:E6U810"
FT                   /inference="similar to AA sequence:KEGG:SSA_0827"
FT                   /protein_id="ADU25942.1"
FT                   /translation="MADHQPFIVQTGQSHAVRDGCSARMDEAGAQAAETQPRPTYTQMV
FT                   IHKTLGVYFARPYSLAACSELVRRLRSLAFILLAAAGIAGLVLGAGAPAFSVVWVACGI
FT                   ALVLWGIGVFLFGFARSLLMWPAAVGCAALYTGVRFALSWAWGLSPVLFAALAAFLLAV
FT                   LAGVIFRLAKRFVIASSVTFWQYERDGILCAADLPLGEMPPVAGYTVFLRGEVPVSFDA
FT                   EQEPAEEVDILLEDCVFFCRRKRLVFCGYALDARQKRLTLYLYARGVRQSRRAFKRFLK
FT                   RRGLEASVTCSTDADWQRFHEEVYPDDTEYQQIHNRFLYDNMEADGFDFSQAVPQVYTF
FT                   YFARREDARAFAEQAVPLGYEGSRYYDREREASVDGDGPAFAHAVCVQLTGRVGLARMD
FT                   CNTGRAVELARQFHGRFYEWEVGVLEPDASTAST"
     atggcggacc atcagccttt catcgtccaa acggggcaat ctcacgccgt gcgcgatggg        60
     tgttccgcgc ggatggacga agccggcgcg caggctgcgg aaacgcagcc gcggccgacc       120
     tatacgcaga tggtgataca taaaacgctg ggcgtttatt ttgccagacc ctattcgctg       180
     gcggcttgtt cggagctggt gcgccggctt cgttcgctgg cgttcattct gctggcggcg       240
     gcgggcatcg ccggtctggt gctgggtgcg ggtgcaccgg ctttttccgt cgtctgggtg       300
     gcgtgcggca tcgcgctggt gctttggggc atcggcgttt tcctgtttgg gtttgcgcgc       360
     tctttgctca tgtggccggc ggctgtcggc tgtgccgcgc tctataccgg cgtgcggttc       420
     gcactttcgt gggcatgggg gctgtccccg gttttgtttg ccgcgctggc ggctttcctg       480
     ctggcggttt tggccggcgt gatctttcgg ctggccaagc ggttcgtcat cgcgtccagc       540
     gtaacgttct ggcagtatga gcgcgacggc atcctgtgcg cggctgacct tccgttgggc       600
     gagatgcctc cggtggccgg atataccgtg tttttgcgcg gggaggttcc tgtctcgttc       660
     gatgcggagc aggaacctgc ggaggaagtt gacatccttc tggaggactg cgtttttttc       720
     tgccggcgga agcggctggt tttctgcgga tatgcgctgg acgcgcggca gaagcggctg       780
     acgctgtacc tttacgcgcg tggagtccgg caaagcaggc gcgcgttcaa acggtttttg       840
     aaacgcaggg ggctggaggc atcggtgacc tgcagcaccg atgcggactg gcagcgcttc       900
     catgaagagg tctatccgga cgacacggaa tatcagcaga tccacaaccg gtttttatac       960
     gacaatatgg aggcggacgg ctttgatttt tcacaggccg tgccgcaggt ctatacgttt      1020
     tattttgccc ggcgggaaga cgcgcgtgcc ttcgcggagc aggctgtgcc gctcggctac      1080
     gagggcagcc ggtattatga ccgggagcgg gaagcgagtg tggacggcga cggtcccgct      1140
     tttgcgcatg ccgtctgcgt gcagttgact ggtcgggtgg gccttgcgcg tatggattgc      1200
     aacaccggcc gcgccgtgga gcttgccaga caatttcacg ggcggttcta cgagtgggag      1260
     gtcggggtgc tggagccgga tgcttcgacg gcatcaacat aa                         1302
//

If you have problems or comments...

PBIL Back to PBIL home page