(data stored in ACNUC9435 zone)

EMBL: CP002400.PE353

CP002400.PE353       Location/Qualifiers
FT   CDS_pept        complement(390724..391857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0359"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0947 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25944"
FT                   /db_xref="UniProtKB/TrEMBL:E6U812"
FT                   /inference="similar to AA sequence:KEGG:Cphy_0947"
FT                   /protein_id="ADU25944.1"
FT                   /translation="MKKKLLALGCGLLLLAGCSIAPHHTTPAISARISAPQSGQSAASE
FT                   GSGAPSAPVLKGPLFTAGSGPYLPPAGTVQTVDSAAADEIHLYWEKAYPLAQNPPDFAF
FT                   YDANDPVSEDAGEETALLQKYGANLYLKGLKETSYVVQWESAYALIGYCGVPSAKEQAV
FT                   PLLRELEKTSPSKNVRNACTFTLDVLDGSFSSPHISASSDRKTLAFADHFEATLGGGHR
FT                   LWTLRDGKLYLDTLSVDGYTSSIAQAAVSPDGKHVAVNLTGRKGSWGFIITLGQPDTLS
FT                   GELIGTMAAPLQKKGYTLYREGAPANPDWHGVYYSNIQNLSWTGSDTLKLDVDMQVTDH
FT                   PAPSALEGDARLSGTVLYHPSDGTFDFGGLTKSPGVR"
     atgaaaaaaa agctgctcgc actcggatgc ggcctgcttc tgctggcagg ctgctccatc        60
     gcgccgcatc acaccactcc ggccatttcc gcccgaatca gcgcaccgca gtccggccaa       120
     agcgcggctt cggagggctc tggcgccccc tccgctccgg tgctgaaagg cccgcttttc       180
     accgccggca gcggcccgta tctgccgccg gccggcacgg tgcagaccgt cgattccgcc       240
     gccgcggacg agatccatct ctattgggaa aaagcctatc ccctggccca aaacccgccc       300
     gattttgcat tctacgacgc aaacgatccc gtttctgagg atgcgggcga agaaaccgcg       360
     ctgctgcaaa aatacggcgc aaacctctat ctgaaagggt taaaagagac cagctatgtt       420
     gtgcagtggg aaagcgccta tgcgctcatc ggctattgcg gtgtgccgtc ggcaaaagag       480
     caggccgtac ccctgctgcg ggagctggag aaaacctcgc cttccaaaaa cgtgcgaaat       540
     gcctgcactt tcacgctgga cgtgctggat ggctcgtttt ccagcccgca catttccgcc       600
     agcagcgacc gcaaaacact ggcgtttgcc gaccattttg aagccacgct gggcggcgga       660
     caccgcttgt ggaccctccg ggacggtaag ctctatctgg atacgctgag cgtggacggc       720
     tatacctcgt ccatcgcaca ggcggccgtt tcccccgacg ggaagcatgt ggccgtcaac       780
     ctgaccggcc gcaaggggtc gtgggggttc atcatcacgc tcggacagcc cgacacactc       840
     tccggcgagc tcatcggcac gatggccgcg cctctgcaaa aaaagggcta caccctctac       900
     cgtgaaggcg cgcccgccaa tccggattgg cacggcgtct attacagcaa catccaaaac       960
     ctttcatgga cgggcagcga caccctcaag ctggatgtag acatgcaggt caccgaccac      1020
     cccgccccct cggcacttga gggggatgcc cgactgtcgg gtacggtgct ataccatccg      1080
     tccgacggta cgttcgactt cggcggactt accaagtccc ccggtgtcag atga            1134
//

If you have problems or comments...

PBIL Back to PBIL home page