(data stored in ACNUC9435 zone)

EMBL: CP002400.PE355

CP002400.PE355       Location/Qualifiers
FT   CDS_pept        393437..393721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0361"
FT                   /product="Chaperonin Cpn10"
FT                   /note="PFAM: Chaperonin Cpn10; KEGG: cth:Cthe_2891
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25946"
FT                   /db_xref="GOA:E6U814"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:E6U814"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ADU25946.1"
FT                   /translation="MALKPLADRVVIKLVEAEETTRGGIILPDNAKEKPQVAEVVAVGP
FT                   GGLVDGKEVQMYLQPGQKVIASKYAGTEVKVDGEEYTIVRQNDILAVVE"
     atggcactga aacctcttgc ggacagagtc gttattaaac tggtcgaggc ggaggaaacc        60
     acccggggcg gcatcatcct gccggacaac gccaaggaaa aaccccaggt ggcggaagtg       120
     gtcgcggtgg gtcccggcgg cctggtggac ggcaaggaag tgcagatgta tctgcagcct       180
     ggccagaagg tcatcgccag caaatatgcc ggcaccgaag tgaaggtcga tggggaagaa       240
     tacaccatcg tgcggcagaa cgacattctg gccgttgtgg aataa                       285
//

If you have problems or comments...

PBIL Back to PBIL home page