(data stored in ACNUC9435 zone)

EMBL: CP002400.PE357

CP002400.PE357       Location/Qualifiers
FT   CDS_pept        395684..397126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0363"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; KEGG:
FT                   cno:NT01CX_0337 prolyl-tRNA synthetase; PFAM: Prolyl-tRNA
FT                   synthetase, class II-like; Anticodon-binding domain
FT                   protein; tRNA synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25948"
FT                   /db_xref="GOA:E6U816"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E6U816"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ADU25948.1"
FT                   /translation="MAQDGGKKLVEAITPMEEDFAKWYTDIVKKAELVDYSSMRGCLFI
FT                   RPYAYAIWENIQKVLDAKFKETGHENVYMPLFIPESLLQKEKDHIEGFAPEVAWVTHGG
FT                   GEKLEERLCVRPTSETLFCEHYSHIVHSYRDLPKLYNQWCSVVRWEKTTRPFLRSLEFL
FT                   WQEGHTLHETEAEAREETTRMLNIYADFCEQVLAMPVVKGRKTEKEKFAGAVDTCSIEA
FT                   MMHDGKALQSGTSHYLGDGFTHAFDIQYTGRDNTLKYPFQTSWGVTTRLIGAIIMVHGD
FT                   DSGLVLPPRIAPTQLVIVPVAMHKPGVLEKANELLVRLQKTLRVKLDASDNSPGWKFAE
FT                   YEMKGVPLRLEIGPRDIEQNRCVVVRRDDRQKIEVSLDELETRLPAILDDVHEALYKKA
FT                   LERQNAMTYACTDWDGFVRTADEKPGFIKAMWCGDQACEEKIKTDAGLTSRNIPFEQEH
FT                   LSDTCICCGKPAKHMVYWGKAY"
     atggcacagg acggcggcaa aaaactggtg gaggccatca cccccatgga agaggacttt        60
     gccaaatggt atacggacat cgtgaaaaaa gcggaactgg tggattattc gagcatgcgc       120
     ggctgcctgt tcattcgtcc gtacgcttac gccatctggg aaaacatcca gaaggtgctg       180
     gatgcgaagt tcaaggaaac cgggcatgag aatgtctata tgccgctgtt catcccggag       240
     agcctgctgc aaaaggaaaa ggaccacatc gagggctttg cgccggaagt cgcgtgggtg       300
     acgcacggcg gtggcgaaaa actggaagaa cggctttgcg tgcgtcccac cagcgagacg       360
     ctgttctgcg agcactattc gcacatcgtg cacagctacc gcgacctgcc caagctgtac       420
     aaccagtggt gctcggtggt gcggtgggaa aagaccaccc ggccgttcct gcgctcactg       480
     gagtttttgt ggcaggaggg gcacaccctg catgagacgg aagcggaagc ccgcgaagaa       540
     accacccgca tgctcaatat ctatgcggat ttttgcgagc aggtgctggc catgccagtg       600
     gtgaaaggcc gaaaaaccga aaaggaaaag ttcgcgggcg cggtggatac ctgctccatc       660
     gaggcgatga tgcacgacgg caaggccctg caaagcggca cgtcgcatta tctgggcgac       720
     gggttcaccc acgcgttcga tatccagtac accgggcggg acaacacgct caaatacccg       780
     ttccagacct cgtggggcgt gaccacccgt ctcatcggtg ccatcatcat ggtgcacggc       840
     gacgacagcg gtctggtgct gccgccccgc atcgcgccca cgcagttggt catcgtgccg       900
     gtagccatgc acaagcccgg cgtgcttgag aaagcaaacg agctgcttgt ccgcctgcag       960
     aagacgctgc gcgtgaagct ggatgcatcc gataactcgc ctggctggaa gtttgccgaa      1020
     tatgagatga aaggcgtgcc cctgcggctg gagatcggcc cgcgggacat cgagcagaac      1080
     cgctgcgtgg tggtgcgccg cgacgaccgg cagaaaatcg aggtctcgtt ggacgaactg      1140
     gaaacgcgcc tgcccgctat tctggacgat gtgcacgaag cgctttacaa aaaagcgctg      1200
     gagcggcaaa acgccatgac ctatgcctgc accgactggg acgggtttgt gcgcacggcg      1260
     gacgaaaagc ccggctttat caaagccatg tggtgcggag accaggcctg cgaggaaaaa      1320
     atcaagacgg acgcgggcct gacctcccgg aacatcccgt ttgagcagga gcatctgtcc      1380
     gatacttgca tctgctgcgg caagcccgct aaacacatgg tctattgggg caaggcctat      1440
     taa                                                                    1443
//

If you have problems or comments...

PBIL Back to PBIL home page