(data stored in ACNUC9435 zone)

EMBL: CP002400.PE372

CP002400.PE372       Location/Qualifiers
FT   CDS_pept        404153..404470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0378"
FT                   /product="ribosomal protein L24"
FT                   /note="TIGRFAM: ribosomal protein L24; PFAM: KOW domain
FT                   protein; KEGG: aco:Amico_0638 ribosomal protein L24; SMART:
FT                   KOW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25963"
FT                   /db_xref="GOA:E6U831"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E6U831"
FT                   /inference="protein motif:TFAM:TIGR01079"
FT                   /protein_id="ADU25963.1"
FT                   /translation="MSKVHVKKGDTVQVISGKDRGKQGKVLEVSPKEGKVIVEGRNMVT
FT                   KHVKPRKMGEQGGIVKAEGALYASKVMIVCPKCGKPTRIGHTIAEDGTKTRVCRKCGAT
FT                   L"
     atgagcaaag tgcacgtcaa aaaaggcgac accgtgcagg tcatttccgg taaggatcgc        60
     ggcaaacagg gcaaagtgct cgaagtgagc cccaaagaag gcaaggtcat cgtggaaggc       120
     cgcaacatgg tcaccaagca tgtcaagccg cgcaaaatgg gtgagcaggg cggcattgtc       180
     aaagccgagg gcgcactgta tgccagcaag gtcatgatcg tctgccccaa gtgcggaaaa       240
     cccacccgta tcggccacac catcgccgag gacgggacca agaccagagt gtgccgcaaa       300
     tgcggcgcaa ctctgtga                                                     318
//

If you have problems or comments...

PBIL Back to PBIL home page