(data stored in ACNUC9435 zone)

EMBL: CP002400.PE377

CP002400.PE377       Location/Qualifiers
FT   CDS_pept        406236..406595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0383"
FT                   /product="ribosomal protein L18"
FT                   /note="KEGG: cno:NT01CX_1131 50S ribosomal protein L18;
FT                   TIGRFAM: ribosomal protein L18; PFAM: ribosomal protein
FT                   L18P/L5E"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25968"
FT                   /db_xref="GOA:E6U8H7"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8H7"
FT                   /inference="protein motif:TFAM:TIGR00060"
FT                   /protein_id="ADU25968.1"
FT                   /translation="MINKPDNNKARLRRHKRVRGKISGTAERPRLNVFRSLHHIYAQVI
FT                   DDVAGVTLVAASTMDKDFEGTGGNKEAAKKVGLAIAKKAAEKGIIEVRFDRGGFVYHGR
FT                   IKELADGAREGGLKF"
     atgatcaaca aacccgacaa caacaaagca cggctgcggc ggcataagcg tgtgcgcgga        60
     aagatttccg gcaccgccga gcgtccgcgt ctgaacgtat tccgctccct ccatcacatc       120
     tacgcgcagg tcatcgacga tgtcgcgggc gtgacgcttg tcgccgcatc cacgatggat       180
     aaagatttcg aaggaacggg cggaaacaaa gaggcggcca aaaaagtcgg ccttgcaatc       240
     gccaaaaaag cggcggaaaa aggcattatc gaagtgcggt tcgaccgcgg cggatttgtc       300
     tatcatggcc gtatcaaaga actcgcagat ggcgcccgtg agggcggcct gaagttctga       360
//

If you have problems or comments...

PBIL Back to PBIL home page