(data stored in ACNUC9435 zone)

EMBL: CP002400.PE379

CP002400.PE379       Location/Qualifiers
FT   CDS_pept        407143..407322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0385"
FT                   /product="ribosomal protein L30"
FT                   /note="KEGG: clj:CLJU_c40860 50S ribosomal protein L30;
FT                   TIGRFAM: ribosomal protein L30; PFAM: ribosomal protein
FT                   L30"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25970"
FT                   /db_xref="GOA:E6U8H9"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8H9"
FT                   /inference="protein motif:TFAM:TIGR01308"
FT                   /protein_id="ADU25970.1"
FT                   /translation="MAELKITLLKSLSGRKASHIATAHALGLRKIRDEVTQPDNPQTRG
FT                   KINQISYLVEVVEA"
     atggcagaac tgaaaatcac gctgctcaaa agcctgagtg gcagaaaagc gtcccatatc        60
     gccaccgcgc acgcgcttgg cctgcgtaag atccgcgatg aggtcacgca gccggataac       120
     ccccagacgc ggggcaaaat caatcagatc agctatctcg tcgaggtagt ggaagcataa       180
//

If you have problems or comments...

PBIL Back to PBIL home page