(data stored in ACNUC9435 zone)

EMBL: CP002400.PE382

CP002400.PE382       Location/Qualifiers
FT   CDS_pept        409113..409751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0388"
FT                   /product="adenylate kinase"
FT                   /note="KEGG: ate:Athe_1725 adenylate kinase; TIGRFAM:
FT                   adenylate kinase; PFAM: adenylate kinase; adenylate kinase
FT                   lid domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25973"
FT                   /db_xref="GOA:E6U8I2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I2"
FT                   /inference="protein motif:TFAM:TIGR01351"
FT                   /protein_id="ADU25973.1"
FT                   /translation="MNLILLGAPGAGKGTQAENICAHFHIPTISTGNMLREAVKNGTKL
FT                   GLEAKAYMDAGKLVPDAVLVGMIQEKLKEPAYQNGFILDGFPRTVPQAEALDQMGVRID
FT                   TVLEIDVPDERIVARMAGRRVCEICGTSYHTEYRPPKTEGICDADGGRLVQRADDAPET
FT                   VKARLEVYHTQTEPVKAYYAKQDKLSVVEGQEDIADTTRLTLQTLEGRS"
     atgaacctga tcctattggg agccccgggc gccggcaagg gcacgcaggc agaaaacatc        60
     tgtgcacatt tccacattcc caccatttcc accggcaaca tgctgcgcga agcggtgaaa       120
     aacggcacga agctcggcct ggaagccaag gcctatatgg atgcgggcaa actggtgccc       180
     gacgccgtcc tggtgggcat gatccaggaa aagctgaaag agccggcgta tcagaacggc       240
     tttatcctcg acggtttccc gcgcacggtg ccgcaggccg aggcgctcga tcaaatgggc       300
     gtgcggatcg acaccgtgtt ggagatcgac gtgccggacg aacgcatcgt ggcgcgcatg       360
     gcgggccgcc gggtctgtga gatctgtggc acgtcctatc acaccgaata ccgtccgccg       420
     aaaacggaag gtatctgcga cgcggacggc ggcaggctgg tgcagcgcgc cgacgatgcg       480
     cccgagaccg tcaaggcgcg cctggaggtc taccacacgc agaccgagcc ggtcaaggca       540
     tattatgcca agcaagataa actttccgtg gtggaggggc aggaggatat cgccgatacc       600
     acccgcctga ccctgcaaac gttagaaggc cggtcatga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page