(data stored in ACNUC9435 zone)

EMBL: CP002400.PE383

CP002400.PE383       Location/Qualifiers
FT   CDS_pept        409748..410497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0389"
FT                   /product="methionine aminopeptidase, type I"
FT                   /note="KEGG: bts:Btus_0175 methionine aminopeptidase, type
FT                   I; TIGRFAM: methionine aminopeptidase, type I; PFAM:
FT                   peptidase M24"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25974"
FT                   /db_xref="GOA:E6U8I3"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I3"
FT                   /inference="protein motif:TFAM:TIGR00500"
FT                   /protein_id="ADU25974.1"
FT                   /translation="MIILKNEHQLQKMREAGRISQLALLEGGKHVEPGITTADLDHIMH
FT                   EFIVRAGAKPSFLGYGGFPATACISVNNEVIHGIPDKKHKIQNGDIVSIDVGAIYEGFN
FT                   GDNAWTFPAGTISDEAQALLDATRESLFEGIRAAKPGNRVGDIGHAVQSYVEARGFSVV
FT                   RPYVGHGVGEDMHEEPDVPNYGRVGHGARLVPGMVIAIEPMINQGAKEVRTLQNGWTVT
FT                   TVDGSLSAHFEHTVAITENGPVILTAP"
     atgatcattc tgaaaaacga gcatcagctt caaaaaatgc gggaggccgg ccggatctct        60
     cagctggccc tgctggaggg cggcaagcat gtcgaacccg gcatcaccac cgcagatctg       120
     gatcatatca tgcatgaatt cattgtccgg gcgggtgcca aaccgtcgtt cctcggatac       180
     ggcgggttcc cggctaccgc gtgcatctcg gtcaacaacg aagtcatcca cggcatcccg       240
     gacaaaaagc acaagatcca gaatggcgac atcgtcagca tcgatgtggg cgctatttac       300
     gagggtttca acggcgacaa tgcatggacg tttccggccg gcacgatcag cgacgaggcg       360
     caggcgctgc tggacgccac ccgcgagagt ctgtttgaag gtatccgggc ggcaaagccc       420
     ggcaaccgcg tcggcgatat cggccatgcg gtgcagtcct atgtggaggc gcgcggcttt       480
     tcggtggtgc gcccttatgt ggggcacggc gtgggagaag acatgcatga ggagccggat       540
     gttcccaact atgggcgcgt gggacatggc gcaaggcttg ttccgggcat ggtaatcgcg       600
     atcgagccca tgatcaatca gggcgcaaag gaagtccgta ccctgcaaaa cggctggacg       660
     gtcaccacgg tggacggcag cctgtcggca cattttgaac acaccgtcgc catcacggaa       720
     aacggccccg tgattcttac ggccccgtga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page