(data stored in ACNUC9435 zone)

EMBL: CP002400.PE385

CP002400.PE385       Location/Qualifiers
FT   CDS_pept        410788..411006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0391"
FT                   /product="translation initiation factor IF-1"
FT                   /note="KEGG: clj:CLJU_c40820 translation initiation factor
FT                   IF-1; TIGRFAM: translation initiation factor IF-1; PFAM: S1
FT                   IF1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25976"
FT                   /db_xref="GOA:E6U8I5"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I5"
FT                   /inference="protein motif:TFAM:TIGR00008"
FT                   /protein_id="ADU25976.1"
FT                   /translation="MSKDDMIELEGIVREALPNAMFQVELPNNHMILAHISGKLRMNYI
FT                   RILPGDKVTVEMSPYDLTRGRITWRSK"
     ttgtccaaag acgacatgat cgagcttgaa ggtattgtga gagaagcgct gcccaacgcg        60
     atgtttcagg tggagcttcc caataatcac atgattctgg cacacatctc cggcaaactg       120
     cgcatgaact atatccgcat cttgccggga gacaaagtca ccgtggaaat gtccccatac       180
     gacttgaccc gcgggcgcat cacctggcgc tcgaaataa                              219
//

If you have problems or comments...

PBIL Back to PBIL home page