(data stored in ACNUC9435 zone)

EMBL: CP002400.PE389

CP002400.PE389       Location/Qualifiers
FT   CDS_pept        412036..412662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0395"
FT                   /product="ribosomal protein S4"
FT                   /note="TIGRFAM: ribosomal protein S4; PFAM: ribosomal
FT                   protein S4; RNA-binding S4 domain protein; KEGG:
FT                   cce:Ccel_0786 ribosomal protein S4; SMART: RNA-binding S4
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25980"
FT                   /db_xref="GOA:E6U8I9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8I9"
FT                   /inference="protein motif:TFAM:TIGR01017"
FT                   /protein_id="ADU25980.1"
FT                   /translation="MARYTDSVCKLCRREGQKLFLKGERCYSDKCSVGRRSYAPGQHGQ
FT                   DRKKVSEYGIQLRAKQKARRYYGVLERQFRHYFEIAESKPGITGENLLRLLELRLDNVV
FT                   YRLGFASSHAQSRQMVRHGHFTINGKKANIPSMRVRVGDVVAVKEGSRTNEFIKSVVEA
FT                   NASRPIPKWLEINREALSGTVAVLPNREDIDLSVEEHLIVELYSK"
     atggcaagat atacggattc cgtttgcaaa ctctgccgcc gcgaaggcca gaaactgttc        60
     ctgaaaggcg agcgctgcta ttcggataaa tgttcggtgg gccgccgcag ctacgcgccg       120
     ggccagcatg gccaggaccg caagaaagtc tccgagtacg gcatccagct gcgcgccaaa       180
     cagaaagccc gccgctatta cggcgtgctg gagcgccagt tccgccacta cttcgaaatt       240
     gccgagtcca agcccggcat caccggtgag aatctgttgc gtcttctgga gcttcgtctg       300
     gataacgtgg tctaccgtct cggctttgcc agctcgcacg ctcagagccg ccagatggtg       360
     cgccacggcc acttcaccat caatggcaaa aaagccaata tcccgtccat gcgcgtgcgg       420
     gtcggcgatg tggtcgccgt caaagaaggc agccgcacca acgaattcat caagagtgtg       480
     gtggaagcca atgcttcccg cccgattccc aagtggctgg aaatcaaccg cgaggccctt       540
     tcgggcacag tagccgtgct gcccaaccgc gaagacatcg acctgtcggt tgaagagcat       600
     ctcatcgtcg agctgtattc caagtaa                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page