(data stored in ACNUC9435 zone)

EMBL: CP002400.PE393

CP002400.PE393       Location/Qualifiers
FT   CDS_pept        complement(414487..414957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0399"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding protein"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: cth:Cthe_0219 5-nitroimidazole
FT                   antibiotic resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25984"
FT                   /db_xref="GOA:E6U8J3"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR024747"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J3"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ADU25984.1"
FT                   /translation="MRRNDREVTDPDEQIAIMQRCDVCRLAFFDADSPYIVPMNFGFEQ
FT                   ACDTLLLYFHCAKTGKKLDCLAADPRVSFEMDGAHRLLEADSACGYSMEYESVIGRGTA
FT                   RLLGDAEKAHALQCIMRHYRPGKTFVFDLRMMDAVAVFQVSVQSLTAKRLKK"
     gtgagaagaa acgaccgtga agtgaccgat ccggacgaac aaatcgccat catgcaacgc        60
     tgcgatgtct gccgcctggc tttttttgat gcggacagcc catatatcgt gccgatgaat       120
     ttcggatttg agcaggcctg cgacacactc ctgctctatt ttcattgcgc caaaaccggc       180
     aaaaagctgg actgccttgc ggcagacccg cgggtgtcct ttgagatgga tggtgcacac       240
     cgcctgctgg aagcagattc ggcatgcggc tatagcatgg aatatgagag cgtgatcggc       300
     cggggtaccg cccgactgct gggcgatgcc gaaaaagcgc atgcgctcca gtgcatcatg       360
     cggcactacc ggcccggcaa gacctttgtg tttgacctgc ggatgatgga cgccgtcgcg       420
     gtgtttcagg tgtcggtgca gtccctgacg gcgaaacggc tgaagaaata g                471
//

If you have problems or comments...

PBIL Back to PBIL home page