(data stored in ACNUC9435 zone)

EMBL: CP002400.PE394

CP002400.PE394       Location/Qualifiers
FT   CDS_pept        complement(414986..415669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0400"
FT                   /product="MTA/SAH nucleosidase"
FT                   /EC_number="3.2.2.9"
FT                   /note="TIGRFAM: MTA/SAH nucleosidase; KEGG:
FT                   bcb:BCB4264_A2883 bifunctional
FT                   5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase/phosphatase; PFAM: purine or other
FT                   phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25985"
FT                   /db_xref="GOA:E6U8J4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8J4"
FT                   /inference="protein motif:TFAM:TIGR01704"
FT                   /protein_id="ADU25985.1"
FT                   /translation="MAKIGVLSAMPVEIESIIQKCGAKPLSTPHFYKVWEGTYGNNTVL
FT                   FACSGIGKVNAAACAQHLIDAFGVDCIINMGIAGGIAKDLHTLDVVIGNEVFYHDFNPA
FT                   SLLEKYYPFQARFTCDARLAEIARNVCTATPEVECFRMGDIASGDCFVEAGETKALIRE
FT                   LGGVCCEMEGAAIGHVCFLNEVPFLIVRTISDLADETAPITYEEFEQKASVQSNHVVEG
FT                   ILKAI"
     atggcaaaaa tcggcgtact gtcggccatg ccggtcgaaa ttgagagcat catccaaaaa        60
     tgcggtgcca aaccgctctc cactccgcat ttctataaag tgtgggaagg cacatatgga       120
     aacaataccg tcctgtttgc gtgcagcggc atcggcaaag tgaacgcggc ggcctgcgcc       180
     cagcacctta tcgacgcgtt cggggtagac tgcatcatca atatgggcat tgcgggcggc       240
     attgccaaag acctgcacac cctcgatgtg gtcatcggga acgaggtttt ctaccacgat       300
     tttaacccgg cctccctgtt ggaaaaatac tatccattcc aggcgcgctt cacctgcgat       360
     gcgcgcctgg cggagattgc ccggaacgtc tgcacagcca caccggaagt ggagtgcttt       420
     cgcatggggg atattgcgtc cggcgactgc tttgtggaag caggcgagac caaagcactt       480
     atccgtgaac tgggcggtgt gtgctgcgag atggagggcg ccgccatcgg gcacgtatgc       540
     ttcctcaacg aagtaccgtt tctgatcgtg cgcaccatct ccgatctggc agacgaaacc       600
     gcgcccatca cctatgagga atttgaacag aaagcctccg tccagtccaa ccatgtggtg       660
     gaaggcatcc tgaaggccat ctga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page