(data stored in ACNUC9435 zone)

EMBL: CP002400.PE4

CP002400.PE4         Location/Qualifiers
FT   CDS_pept        3295..4422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: cth:Cthe_2374 DNA replication and repair
FT                   protein RecF; TIGRFAM: DNA replication and repair protein
FT                   RecF; PFAM: SMC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25595"
FT                   /db_xref="GOA:E6U5C8"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5C8"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ADU25595.1"
FT                   /translation="MIVHRLSLQGFRNLEQTVLEPDPSVNIFYGQNAQGKTNLLEAIWL
FT                   FTGARSFRGAKDSELVGFQAEKADLSLSFTAGGRLQEAVLSIREGRRYARLNDVPLQSP
FT                   AGLSGEFCAVIFSPEHLSLVKDGPSVRRAFLDEAICPLRPRHAAILAAYHKALIQRNAL
FT                   LKDIPHHMDLLDTLDVWDERVGKLGAAILHARLRYLARLLPKAERLHQSISNSHEQAAF
FT                   RYESAKGLQNVLDDPGRHASEIEQALRAAMRERRRADLETGVTGVGPHRDDLTISVAER
FT                   PARSFASQGQQRTAALALKLAEAEVLTDVMGEPPVLLLDDVFSELDGSRRDYLMHHIDG
FT                   AQVFITCCDPQELASSAGAVFSLSNGQIRRGFHAS"
     atgatcgttc accgcctgtc tttacaggga ttccgaaacc tggaacaaac cgtgctggaa        60
     cccgacccgt cggtcaatat cttctatggg caaaacgcgc agggcaaaac caacctgttg       120
     gaagctatct ggttgttcac cggcgcgcgc agcttccgcg gcgcgaaaga cagcgaactg       180
     gtcggttttc aggctgaaaa agccgatctc agcctttcgt tcaccgccgg cggccgattg       240
     caggaagcgg ttctctccat ccgggaggga cgccggtacg cgcgactcaa cgacgtgccg       300
     ctgcaaagtc cggccggcct gtccggggaa ttttgcgccg ttattttttc gcccgaacac       360
     ctttcactgg tcaaggatgg gccttcggtc cgccgcgcgt tcctcgatga ggccatttgc       420
     cccctgcgcc cgcgccacgc ggccatcctt gccgcttatc acaaagcgct cattcaacgc       480
     aatgctctgc tcaaagacat cccgcatcat atggacctgc tggatacgct ggacgtctgg       540
     gatgaacgcg tcggcaaact gggcgcggcc attcttcacg caaggctgcg ctacctagcc       600
     cggctgctcc ccaaggcgga acgcctgcac cagtctatct cgaacagcca tgagcaggcc       660
     gctttccggt atgagagcgc aaaaggactg caaaatgtgc tggatgatcc cggccgccac       720
     gcgtcggaaa tcgaacaggc attgcgtgcg gcgatgcgag agcgccgccg cgccgatctg       780
     gaaaccggcg tcaccggcgt tggtccacat cgggacgatc tgacgatttc agtcgcggag       840
     cggcccgccc gctcctttgc ttcgcagggg cagcagcgca cggcggcgct ggcgctgaaa       900
     ctggccgaag cggaagtgct gaccgacgtg atgggggaac cgccggtgct tctgctcgac       960
     gatgtgttca gcgaactgga cggttccagg cgggattatc tcatgcacca catcgatggt      1020
     gcgcaggtct tcattacctg ttgcgaccca caggaactcg cgtcctccgc gggcgcggtc      1080
     ttttccctct caaacgggca aattcgtcgc ggttttcatg cgtcttga                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page