(data stored in ACNUC9435 zone)

EMBL: CP002400.PE40

CP002400.PE40        Location/Qualifiers
FT   CDS_pept        43603..44439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0040"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   KEGG: cth:Cthe_2354 nicotinate-nucleotide pyrophosphorylase
FT                   [carboxylating]; PFAM: Quinolinate phosphoribosyl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25631"
FT                   /db_xref="GOA:E6U5G4"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G4"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ADU25631.1"
FT                   /translation="MILPMHYDEVILRGLKEDINYIDVTTDNLIPEEQQSGAVFLAKED
FT                   GVLCGLDVALRTLRLLDAGVTAEVLRKDGDMLQKGEIIARVHGNTRALLKGERTALNLL
FT                   QHLSGIATATARAVQTVEGTCASVCDTRKTLPGLRVLEKYAVTVGGGKNHRFNLSDAAL
FT                   IKDNHVDAAGGIGKAVATLRARVGHTVKIEVETRDLKELADALAAGADIIMLDNMSLED
FT                   MREAVRVTAGRVPLEASGGVTQETLRGIAETGVNLISIGALTHSVKALDISMKLRD"
     atgattctgc ccatgcatta cgacgaggtc attctgcgcg gactcaaaga ggacatcaat        60
     tacattgacg tgaccaccga caacctcatc ccggaggagc agcagtcggg cgccgtgttt       120
     ctggcgaagg aggacggcgt gctctgcggg ctggacgtgg ccctgcgcac gctgcgcctg       180
     ttggatgccg gggtgacggc ggaggtgctc cgcaaagacg gcgacatgtt gcaaaagggc       240
     gagatcatcg cgcgcgtgca cggcaacacc cgcgcgctgc tcaagggcga gcgcacggcg       300
     ctcaatctgc ttcagcacct gtcgggcatt gccaccgcca ccgcgcgcgc cgtgcaaacg       360
     gtggagggca cctgcgccag cgtctgcgac acccgcaaga ccctgccggg cctgcgcgtg       420
     ctcgaaaaat atgccgtgac ggtgggcggc ggaaaaaacc accgcttcaa cctgtcggac       480
     gccgcgctca tcaaggacaa tcacgtcgat gcggcgggcg gcattggcaa ggcggtggcc       540
     acgctgcgcg cgcgcgtggg gcacacggtc aaaatcgagg tggagacccg ggatctcaag       600
     gagcttgcgg acgcgctggc cgcgggggcg gacatcatca tgctcgacaa catgagcctg       660
     gaggacatgc gcgaggctgt gcgcgtcacg gcggggcgtg tgccgctgga ggcttccggc       720
     ggcgtcacgc aggagactct gcgcggcatt gcggaaaccg gcgtgaatct catttccatc       780
     ggcgccctta cccactcggt gaaagcgctg gacatctcca tgaagctgcg ggactga          837
//

If you have problems or comments...

PBIL Back to PBIL home page