(data stored in ACNUC9435 zone)

EMBL: CP002400.PE433

CP002400.PE433       Location/Qualifiers
FT   CDS_pept        complement(476427..477011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0439"
FT                   /product="signal peptidase I"
FT                   /note="KEGG: afn:Acfer_0473 signal peptidase I; TIGRFAM:
FT                   signal peptidase I; PFAM: Peptidase S24/S26A/S26B,
FT                   conserved region"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26024"
FT                   /db_xref="GOA:E6U8N3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8N3"
FT                   /inference="protein motif:TFAM:TIGR02227"
FT                   /protein_id="ADU26024.1"
FT                   /translation="MEQPISGAAGQPPKNPLLRECYDWMGTLTCTVFVIIFIFTFLLRT
FT                   VSVDGPSMMNTLQNGDHLILAEAGYTPKAGDIVVLYTTAEKQPIIKRVIATAGQTLDID
FT                   YQKHTVKVDGHVLNEPYIREPTAFEGVVPVSMPVTVPAGHIFVMGDNRNNSLDSRSGIV
FT                   GMVDVHDVLGHALIRLFPNPTILQTAPIAVH"
     atggaacaac ccatatccgg ggcggccggg cagccgccga aaaatccgct tctgcgggaa        60
     tgctatgact ggatgggcac gctgacctgc actgtgttcg tcatcatttt catctttact       120
     tttctgctgc gcaccgtgag cgtggacgga ccgtccatga tgaacacgct gcagaacggc       180
     gaccatctca ttctggcgga agcgggatat accccaaaag ccggcgatat cgtggtgctc       240
     tacaccacgg cggaaaagca gcccatcatc aagcgtgtga ttgccacggc cgggcagacg       300
     ttggatatcg actaccagaa gcacaccgtc aaagtggacg gccacgtgct gaacgaaccg       360
     tatatccgcg agcccacggc ctttgagggc gtggttcctg tatccatgcc cgtcaccgtg       420
     ccggccggcc atatcttcgt gatgggcgat aaccgcaaca attcgctgga tagccgcagc       480
     ggcattgtcg gcatggtcga cgtgcacgat gtgctcgggc atgcgttaat ccgcctgttc       540
     cccaacccga cgatcctgca gacagcgccc atcgccgtgc actga                       585
//

If you have problems or comments...

PBIL Back to PBIL home page