(data stored in ACNUC9435 zone)

EMBL: CP002400.PE44

CP002400.PE44        Location/Qualifiers
FT   CDS_pept        50401..50979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0044"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: esi:Exig_2318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25635"
FT                   /db_xref="GOA:E6U5G8"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="InterPro:IPR025720"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G8"
FT                   /inference="similar to AA sequence:KEGG:Exig_2318"
FT                   /protein_id="ADU25635.1"
FT                   /translation="MYTRQQKTLRMIILGLLAAISIVLYYYEVPFFSNYLKLDFSDLPA
FT                   AVAAILFGPLAGIVVELIKNLIFFLTRDIGVTMGYGSLINFIVGTALVVPLSLVVRAWI
FT                   HRGHKWLTAILLGGIAGLASMVAVGVVANYLIAPPFFLHVLHIPLGGTALWAAIGSATI
FT                   LNLVKPVLTAAVLIPVMAAVQKNTHALKV"
     atgtacacac gacagcagaa gaccctgcga atgattatat tggggttgct ggccgccatc        60
     tccatcgtcc tgtattatta cgaggtgccg tttttttcaa actatctgaa attggatttc       120
     agcgacctgc ccgcggcggt tgccgctatt ctgttcggcc cgctggccgg gatcgtggtt       180
     gagttgatca aaaacctcat cttttttctt acgcgcgata tcggcgtgac gatgggttat       240
     ggctcgctga tcaatttcat tgtgggcacg gcgctggttg tcccgctctc gttggtcgtc       300
     cgtgcgtgga tacaccgggg gcataaatgg ctgaccgcca tccttttggg agggatcgcc       360
     gggctggcgt ccatggtcgc ggttggcgtg gttgccaatt atctgattgc accgcccttt       420
     ttcctgcatg tgctgcacat tccgctgggt ggcacggcgc tttgggccgc cattggttcg       480
     gccacgatcc tcaatctggt gaagccggta ttgacggcgg ccgtgctgat tccggtgatg       540
     gctgcggtgc agaaaaacac gcatgccctg aaggtgtga                              579
//

If you have problems or comments...

PBIL Back to PBIL home page