(data stored in ACNUC9435 zone)

EMBL: CP002400.PE447

CP002400.PE447       Location/Qualifiers
FT   CDS_pept        complement(490655..491098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0453"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_3034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26038"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X4"
FT                   /inference="similar to AA sequence:KEGG:Cthe_3034"
FT                   /protein_id="ADU26038.1"
FT                   /translation="MTHASRARPVLLPAERGTSLTFFLLAFLPVLASFFLTTDGRLTTA
FT                   HLGAISIPLRTVCVFHLLTGYNCPVDGMTRTFAFMGHGQLAEALRMSLPGVLLYVFCLF
FT                   EIPLRGVWLVRGRMPRILRVLEPVLFGTVGAVDAVFFLAQFFR"
     atgacacacg cctcccgagc ccgtccggtc ctcctgcccg ccgagcgggg aacctcgctc        60
     actttttttc tgctggcctt tctgccggtg cttgcttcat tcttcctcac caccgacggt       120
     cggttgacca ccgcgcacct cggggcgatt tccatcccgc tgcgcacggt ctgcgtcttc       180
     catctgctca ccggttacaa ctgtccggtg gacggcatga cccgcacgtt cgcgttcatg       240
     gggcacggac agctcgcgga agccctgcgg atgagcctgc ccggcgtgtt gctgtatgtc       300
     ttctgtctgt ttgagatccc gctgcgcggc gtatggctgg tgcgggggcg gatgccgcgc       360
     atacttcgcg tgctggagcc ggtgctgttc ggtaccgtcg gcgcggtgga tgcagtgttt       420
     ttcctcgcac agtttttccg gtga                                              444
//

If you have problems or comments...

PBIL Back to PBIL home page