(data stored in ACNUC9435 zone)

EMBL: CP002400.PE45

CP002400.PE45        Location/Qualifiers
FT   CDS_pept        51152..51961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0045"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /note="PFAM: DNA polymerase beta domain protein region;
FT                   KEGG: ote:Oter_2169 DNA polymerase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25636"
FT                   /db_xref="GOA:E6U5G9"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5G9"
FT                   /inference="protein motif:PFAM:PF01909"
FT                   /protein_id="ADU25636.1"
FT                   /translation="MPTAALGCDTVFEHHQAAIEAATKELSTWDEVLGVIIYGSVAHGF
FT                   ALENSDVDIKIVCTDDFFTAKEHMGNVSYFDRDATPYEGGYVDGEFITPMHIERIAADG
FT                   SESARFDFQDAIVTFDRQGGLEDLVRGAARYPVEQKRRKMVRFYAQFSAWKAHYYEALR
FT                   RDNHYLAHLSALQFALYAGRLFLAYNETLFPGHKWFLQVLSGVPQKPAGLMRCLNTLVD
FT                   QKRAEDVERLYNMVSDFACWPHDSSQDRQFLWDVRMGRIEDFPFAAD"
     atgcctacgg cagccttggg gtgtgatacg gtgtttgaac accatcaggc cgcgatcgaa        60
     gcggccacaa aagaattgtc cacgtgggac gaagtgctgg gcgtcatcat ctatggatcg       120
     gtggcgcatg gctttgcact ggaaaattcg gatgttgaca tcaagatcgt ttgcaccgac       180
     gattttttca ctgccaaaga gcatatgggc aatgtcagtt atttcgaccg ggatgccacc       240
     ccgtatgagg gcggctatgt ggacggtgag tttatcacac cgatgcatat tgagcggatc       300
     gccgcggacg gcagcgaatc cgcccggttc gactttcagg atgccattgt taccttcgac       360
     cgtcagggcg ggctggaaga tctggtgcgg ggagccgccc gttacccggt ggagcagaag       420
     cgccggaaaa tggttcggtt ttacgcgcag ttttccgcgt ggaaagcgca ttattacgag       480
     gcgctgcgtc gggataatca ctatttggcg catctttcgg cgctgcagtt cgcgctgtat       540
     gccgggcggc tgtttctcgc ctataacgag acgctgtttc cggggcacaa gtggtttttg       600
     caggtgcttt cgggcgtgcc gcagaagccc gcggggctga tgcgctgcct gaacacgctg       660
     gttgaccaga aacgcgcgga agatgtggaa cggttgtaca acatggtgtc ggattttgcc       720
     tgttggccgc acgattccag ccaggaccgg cagtttctgt gggatgtccg tatgggacgt       780
     atcgaagatt ttccgttcgc ggcggactga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page