(data stored in ACNUC9435 zone)

EMBL: CP002400.PE451

CP002400.PE451       Location/Qualifiers
FT   CDS_pept        493784..494872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0457"
FT                   /product="Undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="KEGG: gtn:GTNG_0194
FT                   undecaprenyldiphospho-muramoylpentapeptide
FT                   beta-N-acetylglucosaminyltransferase; PFAM: glycosyl
FT                   transferase family 28; Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26042"
FT                   /db_xref="GOA:E6U8X8"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8X8"
FT                   /inference="protein motif:PRIAM:2.4.1.227"
FT                   /protein_id="ADU26042.1"
FT                   /translation="MKKIVLTGGGTAGHITPNLALLPLLQTAGFSISYIGLKDGMEEGL
FT                   IRPTGVAFYGITGGKLRRYADLKNFTDLFRIGAGFWESVSLLRKLKPDVLFSKGGFVST
FT                   PVVWAAKLCGVPVVTHESDSTFGLANRLSAPFARKMCYTFPESGAHLPEDKGVFTGLPI
FT                   REQLLHGNREKGLRLCEFSADKPVLVVTGGSQGAAFINRMVRRCLPKLLETFQVCHLCG
FT                   KGNVDEKLEGMPGYRQFAYVTDDLPDVFAMADMVVTRGGSTSLFELLALQKPMLIIPYS
FT                   RKASRGDQIINGRSFQKQGFGEVLMEADENGMDMMPAAFLRAVRQVYENRERYIENMQK
FT                   SPARGGAQNVFAVLCEVAGLSS"
     ttgaaaaaga tcgtactgac cggcgggggc acggcggggc atatcacgcc caatctcgcg        60
     ctgctgccgc ttttgcagac agccggtttt tccatatcgt atatcgggct caaagacggt       120
     atggaggaag gactcatccg ccctaccggc gtggcgtttt acggcattac cggcggcaaa       180
     ctgcgccgtt atgcggatct gaaaaatttt accgacctgt ttcgcatcgg cgcggggttc       240
     tgggagtcgg tgtcgctgct gcgcaagctc aaaccggatg tgctgtttag taaaggcggg       300
     ttcgtgtcca cgccggtggt gtgggcggcg aagctttgcg gcgtgccggt cgtcacccac       360
     gaatcggaca gcacgttcgg cctggccaac cgtctgagcg ccccgttcgc gcggaagatg       420
     tgctatacgt ttcccgagag cggcgcacat ctgcccgaag acaagggcgt gttcaccggt       480
     ctgcctatcc gtgagcaact gctgcacggc aatcgggaaa agggcctgcg gctctgcgaa       540
     ttttcggcag acaaaccggt gctggtggtt acgggcggca gccagggcgc ggctttcatc       600
     aaccgcatgg tgcgccgctg cctgcccaag ttgctggaga ccttccaggt ttgtcacctc       660
     tgcggcaaag gcaatgtgga tgaaaagctg gagggcatgc cggggtaccg ccagtttgcc       720
     tatgtgaccg acgatctgcc ggatgtgttc gccatggcgg acatggtggt tacacgcggg       780
     ggctccacca gcctgtttga attgctggcc ctgcaaaagc ccatgctcat cattccgtat       840
     tcgcgcaagg ccagccgtgg cgaccagatc atcaacgggc gctcgttcca gaagcagggt       900
     ttcggcgagg tactgatgga agcggacgaa aacggtatgg acatgatgcc ggccgcattt       960
     ttgcgcgcgg tgcggcaggt gtatgagaac cgagagcgct atatcgaaaa catgcaaaaa      1020
     agcccggcgc gcggcggcgc gcagaacgtc ttcgccgttc tctgtgaggt ggcggggctt      1080
     tcgtcgtaa                                                              1089
//

If you have problems or comments...

PBIL Back to PBIL home page