(data stored in ACNUC9435 zone)

EMBL: CP002400.PE465

CP002400.PE465       Location/Qualifiers
FT   CDS_pept        507664..508230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0471"
FT                   /product="restriction modification system DNA specificity
FT                   domain"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: pin:Ping_0149 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26056"
FT                   /db_xref="GOA:E6U8Z2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E6U8Z2"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ADU26056.1"
FT                   /translation="MSTTSVWKTEPLRNVVSYITKGVPPVYAPYESETTVRVLNQKCNR
FT                   NFSISYTESRLHDLSKRNVPYGKYLCDNDILINSTGTGTAGRVAQLYCVPCPTIVDGHM
FT                   IIVRAINDIVPRYLGYAMKAHQAEILQLDEGSTGQTELNRERLLSEIEISYPVSLDEQL
FT                   NIVGILSALDAQISENTKINHHLAA"
     atgagtacga cctctgtgtg gaaaaccgaa ccccttcgta acgttgttag ctatattact        60
     aaaggcgtcc ctcccgttta tgcaccatat gaaagcgaaa cgacggtgag ggttcttaac       120
     caaaaatgca atcgcaattt ttcaataagc tacacagaat cgcggctgca cgatctttca       180
     aagcgaaacg taccatatgg aaaatatcta tgtgataacg atattttgat taactcaacg       240
     ggcaccggaa cggcagggcg tgttgcccaa ttgtattgcg ttccttgtcc gacaattgtt       300
     gatggtcata tgataatcgt gcgcgcaata aatgacatag tgccgcgata tctcggctat       360
     gcgatgaaag ctcatcaagc tgagatattg caactggacg aaggctctac ggggcaaacc       420
     gagcttaatc gcgaacggtt actttcagaa attgaaatat cgtaccccgt ttcgcttgat       480
     gaacagctta atattgtcgg catactatcg gccctcgatg cacagatttc cgaaaacaca       540
     aagataaatc atcatttagc ggcctaa                                           567
//

If you have problems or comments...

PBIL Back to PBIL home page