(data stored in ACNUC9435 zone)

EMBL: CP002400.PE473

CP002400.PE473       Location/Qualifiers
FT   CDS_pept        complement(515878..516660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0479"
FT                   /product="papain cysteine protease family protein"
FT                   /note="KEGG: psp:PSPPH_2358 papain cysteine protease family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26064"
FT                   /db_xref="GOA:E6U900"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR025660"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E6U900"
FT                   /inference="similar to AA sequence:KEGG:PSPPH_2358"
FT                   /protein_id="ADU26064.1"
FT                   /translation="MPHKYTLKKDPEDARDFTFSSLAPVSILHDTDYTAKFPPIWDQGQ
FT                   LGSCQSHAIDAIDVYIKGYAFTPSHLFEYYNVRVIEGTVNQDAGGNLRDTCAALAKNGV
FT                   CDATIWPYDISKFAIKPPQAAYNNANFDNDRIYTYYRVSGIDQIRQALSAGHTPLIGIR
FT                   IYENFESQTTLSTGIIPAPRGALLGGHALVIVGHHDEPASGCKAKEFIQHVFFKKSTGN
FT                   VKIRNSWGTGIGLGGSGYFQASYEVLEQLLMDTWVIVQ"
     atgccgcata aatatacact gaaaaaagac cccgaggacg cgcgcgattt taccttctct        60
     tcacttgcgc cggtctccat cctgcacgac accgactaca ccgccaaatt tcctcccatt       120
     tgggaccagg ggcagctcgg aagctgccag agtcacgcca tcgacgccat cgatgtctat       180
     atcaagggtt atgcgttcac gccctcccac ctgttcgagt attataatgt ccgcgtcatc       240
     gagggcacgg tcaatcagga cgccggcggc aacctgcgcg acacctgtgc ggctctggcc       300
     aaaaatggcg tgtgcgacgc gaccatttgg ccgtatgaca tctccaagtt tgccataaag       360
     cccccacagg cggcttataa caacgccaat ttcgacaacg acagaatcta cacctactac       420
     cgcgtatccg gcatcgacca gatccggcag gcactttccg ccgggcacac gccgctcatc       480
     ggcatccgga tatacgaaaa ttttgagtcg caaaccacgc tgagcaccgg tatcattccc       540
     gcgccgcgcg gcgcgctcct gggcggtcat gcactggtca tcgtcgggca ccatgacgag       600
     ccggcaagcg gttgcaaggc caaagagttc attcagcatg ttttctttaa aaaatccacg       660
     ggcaatgtca agattcgcaa cagttggggc accggcatcg gactgggcgg cagcggttat       720
     ttccaggcgt cgtatgaggt gctggagcag ctgcttatgg atacgtgggt gatcgtacag       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page