(data stored in ACNUC9435 zone)

EMBL: CP002400.PE477

CP002400.PE477       Location/Qualifiers
FT   CDS_pept        complement(518922..519977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tps:THAPS_6956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26068"
FT                   /db_xref="UniProtKB/TrEMBL:E6U617"
FT                   /inference="similar to AA sequence:KEGG:THAPS_6956"
FT                   /protein_id="ADU26068.1"
FT                   /translation="MYVKLFDRSHIQLDELYQFSPPKYGWTLNDIDTLTLDIALADPKC
FT                   TPANTRLGNHIEYAADDGTTIWGGYIAGHSFNDAKLTLNCVDYNALLKYRRLRAKQYGT
FT                   MDYGSLVRQMIADCQAARSDDPIGLTGYDIAPGAIQTTREVKATDMLLAKIKDFCADAN
FT                   YDYWVDAARVFHFALRRGADKPQYVLEYGGEADNITAAPTLARDILNLANDVYAESTVT
FT                   DDSNNSTTITSEQQDASSQSTYGLYEGTFSPNDGVTDQSTLDTQTQAALALDSAPADSI
FT                   TLTCTDGTLCPFDDLAIGDRVTLHLAPYFDYTASVRVLRMVQDDDKQTREITVGSVVYK
FT                   PQGPQRRAYAG"
     atgtacgtca agctctttga ccgcagccac atacagctcg acgagctgta ccagttcagc        60
     ccgccgaaat acggctggac gctcaacgac atcgacaccc tcacgctgga catcgcgctg       120
     gccgatccca aatgcacacc cgccaacacg cggcttggca accatatcga gtatgcggcg       180
     gacgatggca caacgatttg gggcggatac attgccgggc acagtttcaa cgacgcaaag       240
     ctcactctca actgcgtgga ctacaacgcc ctgctgaaat accgccgcct gcgcgccaag       300
     cagtacggca cgatggatta cggcagcctt gtacggcaga tgattgcgga ctgtcaggcg       360
     gcgcggtcgg atgatcccat cgggctgacc gggtacgaca tcgcgccggg cgcgatccag       420
     acgacgcgcg aggtcaaggc gacggacatg ctgctggcca agatcaaaga cttttgcgcc       480
     gatgccaact acgactactg ggtggatgcc gcccgcgtgt tccatttcgc cctacggcgc       540
     ggcgcggaca agccccagta tgtgctcgaa tacggcggcg aggcggacaa catcaccgcc       600
     gcgcccacac tggcgcgcga catcctgaac ctcgccaacg acgtctacgc cgaaagcacc       660
     gtgaccgacg atagcaacaa cagcacgacc atcaccagcg aacagcagga cgcatccagc       720
     cagtccacct acggcctgta tgagggcacg ttcagcccca atgacggcgt aaccgatcaa       780
     tccacgctgg atacgcagac gcaggcggcg cttgcattgg acagcgctcc ggcggacagc       840
     atcaccctca cctgcaccga cggcacgctc tgcccgtttg acgatctcgc catcggcgac       900
     cgcgtgactc tgcatctcgc gccctacttc gactacaccg ccagcgtgcg ggtgctgcgc       960
     atggtgcagg atgacgacaa acagacgcgc gagatcaccg tgggcagcgt ggtatataag      1020
     ccgcaaggcc cgcagcgccg cgcttacgcc ggataa                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page