(data stored in ACNUC9435 zone)

EMBL: CP002400.PE482

CP002400.PE482       Location/Qualifiers
FT   CDS_pept        525969..526505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0488"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dth:DICTH_1150 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26073"
FT                   /db_xref="InterPro:IPR018649"
FT                   /db_xref="UniProtKB/TrEMBL:E6U909"
FT                   /inference="similar to AA sequence:KEGG:DICTH_1150"
FT                   /protein_id="ADU26073.1"
FT                   /translation="MADDLMDQLPDNVAREIPNTEKIELCLKGTNKEWLVCTTAKLYII
FT                   KKGFMTGHTFGSGIYQMPYKNITGVQTEYHALSGYFQVSTGGMADKPKDYWGKGADRPQ
FT                   ESPNCVTITGKTLLARFRAGCDFINNKIADAHAPVTAAQVPSAADELKKFADLHAQGIL
FT                   TDEEFTAKKKQLLGI"
     atggccgatg atttgatgga tcagctgcct gataacgtgg cacgcgaaat tccgaataca        60
     gaaaagattg agttgtgcct aaaaggcact aacaaggaat ggctggtttg cacgaccgca       120
     aagctctata tcataaaaaa aggatttatg acagggcaca catttggaag cggtatctac       180
     caaatgccgt acaaaaacat tacgggcgtt caaacggaat atcacgcact gtctggatat       240
     tttcaagtaa gcacaggtgg catggcagat aaacccaaag attattgggg aaaaggtgcc       300
     gacaggccac aggaatcccc taactgtgtg acgattaccg gaaaaacact tcttgctaga       360
     tttcgtgccg gttgtgattt cataaataac aagattgcgg acgctcatgc tccggtaacg       420
     gcagcacagg tcccctctgc cgccgacgaa ctaaagaaat ttgccgatct ccacgctcag       480
     ggcattctta ccgatgaaga atttaccgca aaaaagaagc aattgctcgg tatttaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page