(data stored in ACNUC9435 zone)

EMBL: CP002400.PE49

CP002400.PE49        Location/Qualifiers
FT   CDS_pept        complement(55192..56262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0049"
FT                   /product="Radical SAM domain protein"
FT                   /note="KEGG: ere:EUBREC_0234 biotin synthase; PFAM: Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ADU25640"
FT                   /db_xref="GOA:E6U5H3"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024021"
FT                   /db_xref="InterPro:IPR034422"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5H3"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ADU25640.1"
FT                   /translation="MLHAAECTDIVRHGDKPALAALIAKARLAGETERAALFNAADAAR
FT                   RPYYGKNVYFRGLIEFTSYCKNDCYYCGIRAGNRNARHYRLTAEEIWACAAKGYALGFR
FT                   TFVLQGGEDPWYTDARICEIVSGLKERHADCAVTLSIGEKSFESYKRYYDAGADRFLLR
FT                   HETANDAHYRLLHPPELSLAHRKQCLYDLRAIGYQVGAGFMVESPGQTDETLAEDFLFL
FT                   RELQPHMVGIGPFVPHHDTRYAGLPTPTADFTLVLLSLLRLMLPKVLLPATTALGTVDP
FT                   LGREKGLRAGANVVMPNLSPVTHRKDYMLYDNKICTGEEAAECLQCLSRRIASAGFIPD
FT                   FGRGDHADRVEKAARA"
     atgctgcatg cagcggaatg cacggacatt gtacgccacg gcgataaacc ggcgctggcg        60
     gcgctcatcg ccaaagcccg gctggccggg gaaacggagc gcgccgcgct gtttaacgcg       120
     gccgatgcag ccagacggcc atattatggg aaaaacgtct attttcgcgg gctgatcgag       180
     ttcaccagct actgcaaaaa cgactgctat tactgcggta tccgcgccgg gaaccggaac       240
     gcccgccact accgcctgac tgcggaggaa atctgggcct gcgccgccaa aggctatgcg       300
     ctcggcttcc gcaccttcgt tttgcagggc ggggaagacc cgtggtatac cgacgcgcgc       360
     atctgcgaga tcgtgagcgg cctgaaggaa cgccacgccg actgcgccgt taccctttcc       420
     atcggggaaa aatcttttga aagctacaag cggtattatg acgcgggggc cgaccgcttt       480
     ctgcttcggc acgaaacggc aaatgacgcg cattaccggc tgctgcaccc gccggagctc       540
     tcgctcgcac accgcaagca gtgcctgtat gacctgcggg ccatcggtta ccaggtgggg       600
     gcgggcttca tggtggaatc accgggacag accgacgaga ccctcgcaga agatttcctg       660
     tttctgcgcg agttgcagcc gcatatggtg ggcatcggac cgttcgtgcc gcaccacgac       720
     acgcgttatg ccggtctgcc cacccccacg gcggatttca cgctggtgct cctttcgctg       780
     ctgcggctga tgctgccgaa ggtgctgctg cccgccacca cggcgctggg caccgtggac       840
     ccgctgggac gtgaaaaggg cctgcgggcc ggggcaaacg tagtgatgcc caacctctcg       900
     cccgtgaccc accgcaagga ctacatgctg tacgacaaca aaatctgcac cggggaagaa       960
     gcggcggaat gcctgcaatg cctctcgcgg cgcattgctt cggcgggctt tatccccgac      1020
     ttcgggcgcg gcgaccacgc cgaccgggtg gaaaaggcgg cgcgcgcatg a               1071
//

If you have problems or comments...

PBIL Back to PBIL home page