(data stored in ACNUC9435 zone)

EMBL: CP002400.PE492

CP002400.PE492       Location/Qualifiers
FT   CDS_pept        complement(531534..531755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cpc:Cpar_2046 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26083"
FT                   /db_xref="UniProtKB/TrEMBL:E6U919"
FT                   /inference="similar to AA sequence:KEGG:Cpar_2046"
FT                   /protein_id="ADU26083.1"
FT                   /translation="MLQFEESDKTFIRRNLENADALLSGSSLGNVLDALFDLIEEKGYA
FT                   PPHYYDYNDFGRKAQRVYDSVYYLNTQK"
     atgctgcaat ttgaagaaag cgacaaaacc tttatccgcc gaaatcttga aaatgcggat        60
     gcgctgctca gtggatcctc cctcggcaat gtgctggatg ccctgtttga cctgattgaa       120
     gaaaagggat atgcgccccc gcactattac gattacaatg atttcggacg caaggcccag       180
     cgggtatacg acagcgtcta ttacctgaac acacaaaaat aa                          222
//

If you have problems or comments...

PBIL Back to PBIL home page