(data stored in ACNUC9435 zone)

EMBL: CP002400.PE498

CP002400.PE498       Location/Qualifiers
FT   CDS_pept        complement(537645..537971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0504"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dae:Dtox_4224 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26089"
FT                   /db_xref="UniProtKB/TrEMBL:E6U5Z7"
FT                   /inference="similar to AA sequence:KEGG:Dtox_4224"
FT                   /protein_id="ADU26089.1"
FT                   /translation="MDKKELERRIEGGAFAANNGRLLRTINILSGRDIKMRSLQYALPD
FT                   VSKGELAESLYYLQEAGYLHARHAAYGADVDVAEADQDDTEVRLTAKGIQLLKGYAADP
FT                   AVSI"
     gtggataaaa aagaactgga acgccgcatc gagggcggtg cgtttgcagc caacaacggc        60
     cggctgctgc gtaccatcaa catcctgtcc gggcgggata tcaagatgcg cagcctacag       120
     tatgcactgc cggatgtgtc caaaggcgag ctggccgaat ccctgtatta tctgcaggag       180
     gccggatatc tgcatgcgcg gcacgccgcc tacggcgcgg acgtggacgt ggccgaggcc       240
     gatcaggacg ataccgaggt gcggctgacg gccaaaggca ttcagctgct gaaaggctat       300
     gcggccgacc cggcggtatc gatctga                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page