(data stored in ACNUC9435 zone)

EMBL: CP002400.PE500

CP002400.PE500       Location/Qualifiers
FT   CDS_pept        complement(538600..538797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ethha_0506"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cvi:CV_0355 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ethha_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ADU26091"
FT                   /db_xref="GOA:E6U927"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:E6U927"
FT                   /inference="similar to AA sequence:KEGG:CV_0355"
FT                   /protein_id="ADU26091.1"
FT                   /translation="MNLERVTLEDLDGDQRELAELIGMEAYRALATHHGGTYVYVQAPN
FT                   SLLRKDRNEQIRRKFDGKKL"
     atgaatctgg aacgtgttac actggaggat ctggacggcg accagcgcga actcgcggag        60
     ctgatcggca tggaagccta tcgggcactg gccacacacc acggcggaac ctatgtgtat       120
     gtgcaggccc cgaacagcct gcttcgcaaa gaccgcaacg agcagatccg ccggaaattc       180
     gacggaaaaa aactataa                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page